DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Cep97

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_608811.2 Gene:Cep97 / 33610 FlyBaseID:FBgn0031575 Length:806 Species:Drosophila melanogaster


Alignment Length:179 Identity:60/179 - (33%)
Similarity:93/179 - (51%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLT 152
            |.|...::.|:...||...:..|.:..|.|.||:|:|..:|:|.:....|::.::..:..|..|.
  Fly    13 LNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRLHCLR 77

  Fly   153 MLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANL 217
            .|.|..|.:..||.::..::||.|.|..|.|..||:|:|.||||.|:|..|.|..|.::..|.||
  Fly    78 ELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNL 142

  Fly   218 RELYVSENGVETIENLSE--NTKLETLDLAKNRLKGIANLEKLELLEEL 264
            :|||:..|.:..:....:  .|.||||.||||.:..:..:..|..|..|
  Fly   143 KELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
LRR_8 61..117 CDD:290566 7/28 (25%)
leucine-rich repeat 63..84 CDD:275380
LRR_4 83..125 CDD:289563 11/36 (31%)
leucine-rich repeat 85..106 CDD:275380 5/17 (29%)
LRR_8 105..183 CDD:290566 22/77 (29%)
leucine-rich repeat 107..128 CDD:275380 7/20 (35%)
LRR_4 128..168 CDD:289563 10/39 (26%)
leucine-rich repeat 129..150 CDD:275380 3/20 (15%)
LRR_4 149..189 CDD:289563 14/39 (36%)
leucine-rich repeat 151..172 CDD:275380 6/20 (30%)
leucine-rich repeat 173..194 CDD:275380 10/20 (50%)
LRR_8 194..249 CDD:290566 24/56 (43%)
LRR_4 194..235 CDD:289563 15/40 (38%)
leucine-rich repeat 195..216 CDD:275380 8/20 (40%)
leucine-rich repeat 217..238 CDD:275380 5/22 (23%)
Cep97NP_608811.2 leucine-rich repeat 11..31 CDD:275380 5/17 (29%)
leucine-rich repeat 32..53 CDD:275380 7/20 (35%)
LRR_RI <49..189 CDD:238064 47/139 (34%)
LRR_4 76..115 CDD:289563 14/38 (37%)
leucine-rich repeat 76..97 CDD:275380 6/20 (30%)
LRR_8 97..152 CDD:290566 26/54 (48%)
LRR_4 97..137 CDD:289563 19/39 (49%)
leucine-rich repeat 98..119 CDD:275380 10/20 (50%)
leucine-rich repeat 120..141 CDD:275380 8/20 (40%)
LRR_8 140..200 CDD:290566 18/52 (35%)
leucine-rich repeat 142..165 CDD:275380 5/22 (23%)
leucine-rich repeat 166..190 CDD:275380 10/23 (43%)
IQ 581..599 CDD:197470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45973
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.