| Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_724335.2 | Gene: | dtr / 318856 | FlyBaseID: | FBgn0023090 | Length: | 1483 | Species: | Drosophila melanogaster |
| Alignment Length: | 221 | Identity: | 65/221 - (29%) |
|---|---|---|---|
| Similarity: | 104/221 - (47%) | Gaps: | 44/221 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 115 NRLTKIENLDKLVKLEKVYFVSNRITQ-----------IENLDMLTNLTMLELGDNKLKKIENIE 168
Fly 169 MLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENL--EKLANLRELYVSENGVETIE 231
Fly 232 NLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPL 296
Fly 297 AKDVRYRSKLRDILPQLQKIDATLCK 322 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
| LRR_8 | 61..117 | CDD:290566 | 1/1 (100%) | ||
| leucine-rich repeat | 63..84 | CDD:275380 | |||
| LRR_4 | 83..125 | CDD:289563 | 4/9 (44%) | ||
| leucine-rich repeat | 85..106 | CDD:275380 | |||
| LRR_8 | 105..183 | CDD:290566 | 25/78 (32%) | ||
| leucine-rich repeat | 107..128 | CDD:275380 | 5/12 (42%) | ||
| LRR_4 | 128..168 | CDD:289563 | 13/50 (26%) | ||
| leucine-rich repeat | 129..150 | CDD:275380 | 6/31 (19%) | ||
| LRR_4 | 149..189 | CDD:289563 | 17/39 (44%) | ||
| leucine-rich repeat | 151..172 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 173..194 | CDD:275380 | 12/20 (60%) | ||
| LRR_8 | 194..249 | CDD:290566 | 18/56 (32%) | ||
| LRR_4 | 194..235 | CDD:289563 | 15/42 (36%) | ||
| leucine-rich repeat | 195..216 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 217..238 | CDD:275380 | 7/20 (35%) | ||
| dtr | NP_724335.2 | leucine-rich repeat | 38..57 | CDD:275380 | 3/18 (17%) |
| LRR_8 | 56..112 | CDD:290566 | 24/55 (44%) | ||
| LRR_4 | 56..98 | CDD:289563 | 19/41 (46%) | ||
| LRR_RI | 58..>184 | CDD:238064 | 44/144 (31%) | ||
| leucine-rich repeat | 58..79 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 80..101 | CDD:275380 | 12/20 (60%) | ||
| LRR_8 | 100..161 | CDD:290566 | 21/79 (27%) | ||
| leucine-rich repeat | 102..125 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 126..147 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 151..175 | CDD:275380 | 6/42 (14%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45447154 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR45973 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||