| Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001100566.1 | Gene: | Cep97 / 304007 | RGDID: | 1307400 | Length: | 845 | Species: | Rattus norvegicus |
| Alignment Length: | 299 | Identity: | 76/299 - (25%) |
|---|---|---|---|
| Similarity: | 122/299 - (40%) | Gaps: | 45/299 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 63 IERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLV 127
Fly 128 KLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTL 192
Fly 193 V--NLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLS--------ENTKLETLDLAKN 247
Fly 248 RLKGIANLEKL--------ELLEELWLNHNGVD-DWKDIELLKVNKALQTIYLEYNPLAKDVRYR 303
Fly 304 SKLRDIL----------------PQLQKIDATLCKVPGT 326 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
| LRR_8 | 61..117 | CDD:290566 | 18/53 (34%) | ||
| leucine-rich repeat | 63..84 | CDD:275380 | 8/20 (40%) | ||
| LRR_4 | 83..125 | CDD:289563 | 12/41 (29%) | ||
| leucine-rich repeat | 85..106 | CDD:275380 | 5/20 (25%) | ||
| LRR_8 | 105..183 | CDD:290566 | 23/77 (30%) | ||
| leucine-rich repeat | 107..128 | CDD:275380 | 7/20 (35%) | ||
| LRR_4 | 128..168 | CDD:289563 | 10/39 (26%) | ||
| leucine-rich repeat | 129..150 | CDD:275380 | 4/20 (20%) | ||
| LRR_4 | 149..189 | CDD:289563 | 12/39 (31%) | ||
| leucine-rich repeat | 151..172 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 173..194 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 194..249 | CDD:290566 | 17/62 (27%) | ||
| LRR_4 | 194..235 | CDD:289563 | 16/48 (33%) | ||
| leucine-rich repeat | 195..216 | CDD:275380 | 8/20 (40%) | ||
| leucine-rich repeat | 217..238 | CDD:275380 | 6/28 (21%) | ||
| Cep97 | NP_001100566.1 | leucine-rich repeat | 17..37 | CDD:275380 | |
| LRR_RI | <21..126 | CDD:238064 | 26/87 (30%) | ||
| leucine-rich repeat | 38..59 | CDD:275380 | 8/20 (40%) | ||
| leucine-rich repeat | 60..81 | CDD:275380 | 5/20 (25%) | ||
| LRR_8 | 80..136 | CDD:290566 | 17/55 (31%) | ||
| LRR_4 | 80..122 | CDD:289563 | 12/41 (29%) | ||
| leucine-rich repeat | 82..103 | CDD:275380 | 7/20 (35%) | ||
| LRR_4 | 103..143 | CDD:289563 | 10/39 (26%) | ||
| leucine-rich repeat | 104..125 | CDD:275380 | 4/20 (20%) | ||
| LRR_9 | 107..255 | CDD:258718 | 39/157 (25%) | ||
| leucine-rich repeat | 126..149 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 150..171 | CDD:275380 | 4/20 (20%) | ||
| leucine-rich repeat | 172..196 | CDD:275380 | 10/23 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||