Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001127941.1 | Gene: | Lrrc49 / 300763 | RGDID: | 1309466 | Length: | 686 | Species: | Rattus norvegicus |
Alignment Length: | 244 | Identity: | 74/244 - (30%) |
---|---|---|---|
Similarity: | 130/244 - (53%) | Gaps: | 24/244 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 IENLSSLKTLI--ELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNR 138
Fly 139 ITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQAN 203
Fly 204 RIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNH 268
Fly 269 NGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
LRR_8 | 61..117 | CDD:290566 | 11/42 (26%) | ||
leucine-rich repeat | 63..84 | CDD:275380 | 1/7 (14%) | ||
LRR_4 | 83..125 | CDD:289563 | 10/43 (23%) | ||
leucine-rich repeat | 85..106 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 105..183 | CDD:290566 | 24/77 (31%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | 2/20 (10%) | ||
LRR_4 | 128..168 | CDD:289563 | 13/39 (33%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 149..189 | CDD:289563 | 17/39 (44%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 7/20 (35%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 13/20 (65%) | ||
LRR_8 | 194..249 | CDD:290566 | 21/54 (39%) | ||
LRR_4 | 194..235 | CDD:289563 | 17/40 (43%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 10/20 (50%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 6/20 (30%) | ||
Lrrc49 | NP_001127941.1 | leucine-rich repeat | 94..111 | CDD:275380 | 4/16 (25%) |
LRR_4 | 112..153 | CDD:289563 | 16/62 (26%) | ||
leucine-rich repeat | 114..135 | CDD:275380 | 9/42 (21%) | ||
LRR_4 | 134..176 | CDD:289563 | 19/41 (46%) | ||
leucine-rich repeat | 136..157 | CDD:275380 | 7/20 (35%) | ||
LRR_8 | 156..212 | CDD:290566 | 28/55 (51%) | ||
LRR_4 | 156..198 | CDD:289563 | 23/41 (56%) | ||
leucine-rich repeat | 158..179 | CDD:275380 | 13/20 (65%) | ||
LRR_4 | 178..220 | CDD:289563 | 17/41 (41%) | ||
leucine-rich repeat | 180..201 | CDD:275380 | 10/20 (50%) | ||
LRR_8 | 202..256 | CDD:290566 | 15/53 (28%) | ||
leucine-rich repeat | 202..223 | CDD:275380 | 6/20 (30%) | ||
LRR_4 | 223..263 | CDD:289563 | 9/39 (23%) | ||
leucine-rich repeat | 224..245 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 246..270 | CDD:275380 | 5/23 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |