DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Lrrc9

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_038967924.1 Gene:Lrrc9 / 299129 RGDID:1565716 Length:1188 Species:Rattus norvegicus


Alignment Length:302 Identity:86/302 - (28%)
Similarity:142/302 - (47%) Gaps:54/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SIEDIITIDPDCYE------LDLNHRRIEKLENFEPLTRIERLFLRWNLIKKI-ENLSSL----K 83
            |..:...:| |.|.      ||.:|..:..||.|..|.:::.|.|.||.:||. |.::.|    .
  Rat   715 SFNEFTCLD-DVYHLYNLEYLDASHNHVITLEGFRGLMKLKHLDLSWNQLKKTGEEINVLCKHTT 778

  Fly    84 TLIELELYDN--------QITKIENLDDLPHLEVLDIS---------FNRLTKIENL-------- 123
            :|:.|::..|        :::.|..|..|.||:.|.||         |...|||..|        
  Rat   779 SLLTLDIQHNPWQKPATLRLSVIGRLKTLTHLDGLLISEEETRAALKFISGTKITQLTLLQHSSS 843

  Fly   124 -DKLVKLEKVYFVSNRITQIENL--------DMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLG 179
             ::..::..::..:..:|||..|        :....:|.|.|....|.:|.|:|.|.||:.....
  Rat   844 KEERPRMLSIWPSAKILTQISKLGPHFHLTGNWYLKITALNLDGQHLFEITNLEKLENLKWASFS 908

  Fly   180 KNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSEN---GVE--TIENLSENTKL 239
            .|.::|:|.|::.||||.|:|..|.|.|||.:.:|..|..|.::.|   |:|  |.:|:   ..|
  Rat   909 NNNLSKMEGLESCVNLEELTLDGNCISKIEGITRLTKLSRLSMNNNLLTGLEKHTFDNM---LHL 970

  Fly   240 ETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLK 281
            .:|.|..||:..::.|:|...|.||::::|.:...::|..||
  Rat   971 HSLSLENNRITSLSALQKTFTLIELYISNNYIAVNQEIYNLK 1012

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 7/24 (29%)
LRR_8 61..117 CDD:290566 20/77 (26%)
leucine-rich repeat 63..84 CDD:275380 8/25 (32%)
LRR_4 83..125 CDD:289563 16/67 (24%)
leucine-rich repeat 85..106 CDD:275380 6/28 (21%)
LRR_8 105..183 CDD:290566 25/103 (24%)
leucine-rich repeat 107..128 CDD:275380 9/38 (24%)
LRR_4 128..168 CDD:289563 10/47 (21%)
leucine-rich repeat 129..150 CDD:275380 4/28 (14%)
LRR_4 149..189 CDD:289563 13/39 (33%)
leucine-rich repeat 151..172 CDD:275380 8/20 (40%)
leucine-rich repeat 173..194 CDD:275380 5/20 (25%)
LRR_8 194..249 CDD:290566 22/59 (37%)
LRR_4 194..235 CDD:289563 18/45 (40%)
leucine-rich repeat 195..216 CDD:275380 10/20 (50%)
leucine-rich repeat 217..238 CDD:275380 7/25 (28%)
Lrrc9XP_038967924.1 leucine-rich repeat 47..77 CDD:275380
leucine-rich repeat 78..99 CDD:275380
PPP1R42 85..236 CDD:411060
leucine-rich repeat 100..121 CDD:275380
leucine-rich repeat 122..143 CDD:275380
leucine-rich repeat 144..166 CDD:275380
leucine-rich repeat 167..191 CDD:275380
leucine-rich repeat 192..223 CDD:275380
internalin_A 685..>1014 CDD:380193 86/302 (28%)
leucine-rich repeat 689..708 CDD:275380
leucine-rich repeat 709..730 CDD:275380 4/15 (27%)
leucine-rich repeat 731..752 CDD:275380 7/20 (35%)
leucine-rich repeat 753..779 CDD:275380 8/25 (32%)
leucine-rich repeat 780..806 CDD:275380 5/25 (20%)
leucine-rich repeat 807..865 CDD:275380 14/57 (25%)
leucine-rich repeat 866..901 CDD:275380 9/34 (26%)
PPP1R42 879..1057 CDD:411060 47/137 (34%)
leucine-rich repeat 902..923 CDD:275380 5/20 (25%)
leucine-rich repeat 924..945 CDD:275380 10/20 (50%)
leucine-rich repeat 946..969 CDD:275380 7/25 (28%)
leucine-rich repeat 992..1016 CDD:275380 7/21 (33%)
leucine-rich repeat 1017..1044 CDD:275380
leucine-rich repeat 1045..1112 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.