DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Lrguk

DIOPT Version :10

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_017448017.1 Gene:Lrguk / 296968 RGDID:1308226 Length:1271 Species:Rattus norvegicus


Alignment Length:265 Identity:77/265 - (29%)
Similarity:129/265 - (48%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ERLFLRWNL----IKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLD 124
            |:::...||    :..:..||....|.:|.|..|:|..:..:..:|:|..|:.|.||||...|..
  Rat   125 EQVYRNLNLSHCELIDVSILSGYVHLQKLNLSGNRIEDLSCVSCMPYLLELNASQNRLTTFFNFK 189

  Fly   125 KLVKL-EKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIEN 188
            ....| :||.|.||:|:::.:|.....||.|.|.:|::::|..:|..::|..|.|..|:|..|:.
  Rat   190 PPQNLKQKVDFSSNQISEMYDLSAYHTLTQLILDNNEIEEITGLEKCISLTHLSLAGNRITTIKG 254

  Fly   189 LDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIA 253
            |.|| .:::||                      ||.|.:|||..|.|...|:.|||:.|::..:.
  Rat   255 LGTL-PIKVLS----------------------VSNNQIETITGLEELKALQNLDLSHNQISSLH 296

  Fly   254 NLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDA 318
            .||..:|||.:.|..|.:.:..:||.::....|:.:.|..||:.....|...:..:|.:|.::|.
  Rat   297 GLENHDLLEVINLEDNKIKELSEIEYIENLPILRVLNLLRNPIQTKPEYWFFVIFMLLRLTELDQ 361

  Fly   319 TLCKV 323
            ...||
  Rat   362 QKIKV 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
PPP1R42 44..208 CDD:455733 45/148 (30%)
leucine-rich repeat 63..84 CDD:275380 5/23 (22%)
leucine-rich repeat 85..106 CDD:275380 5/20 (25%)
leucine-rich repeat 107..128 CDD:275380 8/20 (40%)
leucine-rich repeat 129..150 CDD:275380 8/21 (38%)
PPP1R42 132..317 CDD:455733 53/184 (29%)
leucine-rich repeat 151..172 CDD:275380 7/20 (35%)
leucine-rich repeat 173..194 CDD:275380 9/20 (45%)
leucine-rich repeat 195..216 CDD:275380 2/20 (10%)
leucine-rich repeat 217..238 CDD:275380 8/20 (40%)
LrgukXP_017448017.1 LRR 96..>340 CDD:443914 71/237 (30%)
leucine-rich repeat 129..149 CDD:275380 4/19 (21%)
leucine-rich repeat 150..171 CDD:275380 5/20 (25%)
leucine-rich repeat 172..194 CDD:275380 8/21 (38%)
leucine-rich repeat 196..216 CDD:275380 7/19 (37%)
leucine-rich repeat 217..238 CDD:275380 7/20 (35%)
leucine-rich repeat 258..281 CDD:275380 11/45 (24%)
leucine-rich repeat 282..300 CDD:275380 6/17 (35%)
leucine-rich repeat 304..328 CDD:275380 6/23 (26%)
GMPK 416..592 CDD:238026
PHA03247 <680..1192 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.