Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163867.1 | Gene: | Lrrc43 / 288751 | RGDID: | 1561461 | Length: | 681 | Species: | Rattus norvegicus |
Alignment Length: | 366 | Identity: | 81/366 - (22%) |
---|---|---|---|
Similarity: | 134/366 - (36%) | Gaps: | 124/366 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 RIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENL--DDLPHLEVLDISFNRLTKIENLD 124
Fly 125 KLVKLEKVYFVSNRITQIENLDM----LTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAK 185
Fly 186 IE-----NLDTLVNL-----------------------EILSLQANRIVKIENLEKLANLREL-- 220
Fly 221 -------------YVSENGVET---------IENLSENTKLETLDLAKNRLKGIANLEKLELLEE 263
Fly 264 -----------LWLNHNGV--------------------------------DDWKDIELLKVNKA 285
Fly 286 LQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDATLCKVPGT 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | 81/366 (22%) |
LRR_8 | 61..117 | CDD:290566 | 21/56 (38%) | ||
leucine-rich repeat | 63..84 | CDD:275380 | 7/20 (35%) | ||
LRR_4 | 83..125 | CDD:289563 | 15/43 (35%) | ||
leucine-rich repeat | 85..106 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 105..183 | CDD:290566 | 25/81 (31%) | ||
leucine-rich repeat | 107..128 | CDD:275380 | 5/20 (25%) | ||
LRR_4 | 128..168 | CDD:289563 | 14/43 (33%) | ||
leucine-rich repeat | 129..150 | CDD:275380 | 8/24 (33%) | ||
LRR_4 | 149..189 | CDD:289563 | 12/44 (27%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 173..194 | CDD:275380 | 8/25 (32%) | ||
LRR_8 | 194..249 | CDD:290566 | 15/101 (15%) | ||
LRR_4 | 194..235 | CDD:289563 | 13/87 (15%) | ||
leucine-rich repeat | 195..216 | CDD:275380 | 6/43 (14%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 7/44 (16%) | ||
Lrrc43 | NP_001163867.1 | LRR_RI | <146..254 | CDD:238064 | 41/124 (33%) |
LRR_8 | 146..203 | CDD:290566 | 21/56 (38%) | ||
LRR_4 | 146..187 | CDD:289563 | 17/40 (43%) | ||
leucine-rich repeat | 147..168 | CDD:275378 | 7/20 (35%) | ||
leucine-rich repeat | 169..192 | CDD:275378 | 9/22 (41%) | ||
LRR_8 | 191..256 | CDD:290566 | 25/81 (31%) | ||
leucine-rich repeat | 193..219 | CDD:275378 | 10/33 (30%) | ||
leucine-rich repeat | 220..245 | CDD:275378 | 9/33 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45973 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |