DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and cdc11

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_588419.1 Gene:cdc11 / 2539149 PomBaseID:SPCC1739.11c Length:1045 Species:Schizosaccharomyces pombe


Alignment Length:390 Identity:96/390 - (24%)
Similarity:162/390 - (41%) Gaps:101/390 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GDADRAMNEPEAAKTVSGIQVIPAEDVASIEDIITIDP---DCYELDLNHRRIEKLENFEPL-TR 62
            |...:|..:.|.:.:||...:|..     :.|:...:|   ...:||::.|.::.|.....| ..
pombe   568 GLKSKADKDAEYSFSVSRQSIIQI-----LSDVEPYEPFWKRIIQLDISRRHLDSLIGLSELCPS 627

  Fly    63 IERLFLRWNLI-----------------KKIENLSSLKTLIELELYD---NQITKIENLDDLPHL 107
            ||.|.|..|.|                 .::.:|:|...|:.|:..|   ||:..:..|..|.||
pombe   628 IEELTLEGNEIAYLTGCPVTIRDLNAVENRLSSLTSFSNLLNLQYLDISYNQLEDLTGLSSLIHL 692

  Fly   108 EVLDISFNRLTK---IENLDKLVK--------------------LEKVYFVSNRITQIENLDMLT 149
            ..|.:..|.|..   |::||.|:|                    ||::...:|.|.:||.:..|.
pombe   693 RELKVDSNHLWSLDGIQHLDGLLKLSACNNRIKELSFTNSNLHRLEELLLGNNEIEEIEEISSLQ 757

  Fly   150 NLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVK---IENL 211
            ||.:|:|.:|||..::..:.:::||.|.:..|.|.::| :|...:|..|.:..||..:   |..|
pombe   758 NLMVLQLDNNKLTNLKASQPMIHLRILRISNNAIHQLE-VDQFPHLRTLYMDLNRFNRPPDIRRL 821

  Fly   212 EKLAN--------------------LRELYVSEN------------GVETIE----NLSENTK-- 238
            ::|.|                    :|.||:|.|            ||..:|    .|.|..|  
pombe   822 KRLVNFSFRTQDPEASNFVIQPSLDIRNLYLSNNTFVTLDCKHMFLGVRYLELANVQLKEVPKYI 886

  Fly   239 ------LETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDI-ELLKVNKALQTIYLEYNPL 296
                  |..|||:.|.:..|.:|:.|:::..|:|..|.:...::: ::|...|.|..:.|..|||
pombe   887 ATSMPNLRVLDLSHNYISDIESLKPLQMIHRLYLVGNRIKKMRNLCDILANLKQLNVLDLRMNPL 951

  Fly   297  296
            pombe   952  951

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 5/19 (26%)
LRR_8 61..117 CDD:290566 19/75 (25%)
leucine-rich repeat 63..84 CDD:275380 8/37 (22%)
LRR_4 83..125 CDD:289563 14/47 (30%)
leucine-rich repeat 85..106 CDD:275380 7/23 (30%)
LRR_8 105..183 CDD:290566 28/100 (28%)
leucine-rich repeat 107..128 CDD:275380 8/23 (35%)
LRR_4 128..168 CDD:289563 15/59 (25%)
leucine-rich repeat 129..150 CDD:275380 7/20 (35%)
LRR_4 149..189 CDD:289563 13/39 (33%)
leucine-rich repeat 151..172 CDD:275380 6/20 (30%)
leucine-rich repeat 173..194 CDD:275380 7/20 (35%)
LRR_8 194..249 CDD:290566 24/101 (24%)
LRR_4 194..235 CDD:289563 17/79 (22%)
leucine-rich repeat 195..216 CDD:275380 7/23 (30%)
leucine-rich repeat 217..238 CDD:275380 10/36 (28%)
cdc11NP_588419.1 leucine-rich repeat 608..627 CDD:275380 5/18 (28%)
leucine-rich repeat 628..669 CDD:275380 9/40 (23%)
LRR_4 648..688 CDD:289563 8/39 (21%)
LRR_RI 667..952 CDD:238064 75/286 (26%)
LRR_4 669..710 CDD:289563 12/40 (30%)
leucine-rich repeat 670..691 CDD:275380 6/20 (30%)
leucine-rich repeat 714..736 CDD:275380 2/21 (10%)
leucine-rich repeat 737..758 CDD:275380 7/20 (35%)
LRR_8 758..812 CDD:290566 17/54 (31%)
leucine-rich repeat 759..780 CDD:275380 6/20 (30%)
leucine-rich repeat 781..801 CDD:275380 7/20 (35%)
leucine-rich repeat 802..823 CDD:275380 6/20 (30%)
leucine-rich repeat 824..869 CDD:275380 7/44 (16%)
LRR_8 868..925 CDD:290566 17/56 (30%)
leucine-rich repeat 870..892 CDD:275380 4/21 (19%)
LRR_4 891..931 CDD:289563 11/39 (28%)
leucine-rich repeat 893..914 CDD:275380 8/20 (40%)
leucine-rich repeat 915..940 CDD:275380 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.