DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and Lrrc61

DIOPT Version :10

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_808404.2 Gene:Lrrc61 / 243371 MGIID:2652848 Length:259 Species:Mus musculus


Alignment Length:177 Identity:47/177 - (26%)
Similarity:75/177 - (42%) Gaps:25/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 QIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRI 205
            :.|.|.:...|.....|:..|..|    :|:.||.|     .:..:..|...:|||.|.|..|.:
Mouse    10 EAEALSITPQLLKSHSGEFALDSI----LLLKLRGL-----GVVDLGCLGECLNLEWLDLSGNAL 65

  Fly   206 VKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNG 270
            ..:..|..|..|..|.||.|.:..:|.|:....|::|:.|.|.|.....|:.|..|:.|      
Mouse    66 THLGPLASLRQLAVLNVSNNRLTGLEPLAACENLQSLNAAGNLLTTPGQLQCLAGLQAL------ 124

  Fly   271 VDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID 317
                   |.|::...|..:   .|||..:..|.:.::::||.|:.||
Mouse   125 -------EHLRLRDPLARL---SNPLCANASYWAVVQELLPGLKVID 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380
PPP1R42 44..208 CDD:455733 17/66 (26%)
leucine-rich repeat 63..84 CDD:275380
leucine-rich repeat 85..106 CDD:275380
leucine-rich repeat 107..128 CDD:275380
leucine-rich repeat 129..150 CDD:275380 2/8 (25%)
PPP1R42 132..317 CDD:455733 45/175 (26%)
leucine-rich repeat 151..172 CDD:275380 5/20 (25%)
leucine-rich repeat 173..194 CDD:275380 4/20 (20%)
leucine-rich repeat 195..216 CDD:275380 7/20 (35%)
leucine-rich repeat 217..238 CDD:275380 7/20 (35%)
Lrrc61NP_808404.2 LRR <49..>131 CDD:443914 27/94 (29%)
LRR 1 54..75 7/20 (35%)
leucine-rich repeat 55..76 CDD:275380 7/20 (35%)
LRR 2 76..97 7/20 (35%)
leucine-rich repeat 77..98 CDD:275380 7/20 (35%)
LRR 3 98..119 6/20 (30%)
leucine-rich repeat 99..123 CDD:275380 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.