DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and T05H4.3

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001343670.1 Gene:T05H4.3 / 188149 WormBaseID:WBGene00020266 Length:1150 Species:Caenorhabditis elegans


Alignment Length:295 Identity:78/295 - (26%)
Similarity:139/295 - (47%) Gaps:51/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RRIEKLENF--EPLTRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLD 111
            |.:::.|..  |.|.::..:.::.::.::....:.......:|...||.:||..:.|:       
 Worm   523 RHMDQFEESYNEQLKKLNDMNIKLDVKEERHRRNEEPAETSIEAVSNQQSKIRKVSDV------- 580

  Fly   112 ISFNRLTKIENL------DKL----------VKLEKVYFVSNRITQIENLDMLTNLTMLELGDNK 160
                 |..|.||      :||          :::...||....|.::.  |::|.||.|||.|.|
 Worm   581 -----LANISNLTGRACDEKLPFDWFTMRNPLEIALAYFDFRPIKEVS--DLMTRLTALELCDQK 638

  Fly   161 LKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSEN 225
            |.|:..|:.||:|:.|.:.|||:..::.|:.|..|::|....|.|.|||.|.  ::|..:.:|.|
 Worm   639 LTKLTGIQELVSLQFLSVRKNKLTSLKKLNRLPCLKLLDASFNHISKIEQLP--SSLLHVDLSHN 701

  Fly   226 GVETI---ENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQ 287
            .::|:   ::|. ||:  .|.|.:|::|.:..:|....||..::|.|.:.|..|:||||....|.
 Worm   702 KLQTLVFCQSLG-NTR--HLLLHRNQIKSMKGVESCVQLETFFVNDNLLKDKSDVELLKTMPKLT 763

  Fly   288 TIYLEYNPLAKDVRYRSKL-----------RDILP 311
            .:.:..|.|:....||.::           |.|:|
 Worm   764 HLDMSNNILSSAEGYRPRVMQAAQFLISLDRQIIP 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 4/14 (29%)
LRR_8 61..117 CDD:290566 6/55 (11%)
leucine-rich repeat 63..84 CDD:275380 0/20 (0%)
LRR_4 83..125 CDD:289563 10/47 (21%)
leucine-rich repeat 85..106 CDD:275380 6/20 (30%)
LRR_8 105..183 CDD:290566 27/93 (29%)
leucine-rich repeat 107..128 CDD:275380 6/36 (17%)
LRR_4 128..168 CDD:289563 14/39 (36%)
leucine-rich repeat 129..150 CDD:275380 4/20 (20%)
LRR_4 149..189 CDD:289563 18/39 (46%)
leucine-rich repeat 151..172 CDD:275380 11/20 (55%)
leucine-rich repeat 173..194 CDD:275380 7/20 (35%)
LRR_8 194..249 CDD:290566 18/57 (32%)
LRR_4 194..235 CDD:289563 13/43 (30%)
leucine-rich repeat 195..216 CDD:275380 8/20 (40%)
leucine-rich repeat 217..238 CDD:275380 6/23 (26%)
T05H4.3NP_001343670.1 leucine-rich repeat 69..91 CDD:275380
leucine-rich repeat 92..113 CDD:275380
leucine-rich repeat 114..135 CDD:275380
leucine-rich repeat 136..157 CDD:275380
leucine-rich repeat 158..181 CDD:275380
leucine-rich repeat 182..206 CDD:275380
leucine-rich repeat 629..650 CDD:275380 11/20 (55%)
PLN00113 645..>1005 CDD:331614 48/159 (30%)
leucine-rich repeat 651..672 CDD:275380 7/20 (35%)
leucine-rich repeat 673..692 CDD:275380 8/20 (40%)
leucine-rich repeat 693..714 CDD:275380 5/21 (24%)
leucine-rich repeat 715..761 CDD:275380 16/47 (34%)
leucine-rich repeat 762..815 CDD:275380 8/37 (22%)
leucine-rich repeat 816..851 CDD:275380
leucine-rich repeat 855..875 CDD:275380
leucine-rich repeat 876..903 CDD:275380
leucine-rich repeat 904..952 CDD:275380
leucine-rich repeat 953..973 CDD:275380
leucine-rich repeat 974..994 CDD:275380
leucine-rich repeat 995..1019 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.