| Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_504289.1 | Gene: | R02F11.4 / 178871 | WormBaseID: | WBGene00019842 | Length: | 630 | Species: | Caenorhabditis elegans |
| Alignment Length: | 233 | Identity: | 61/233 - (26%) |
|---|---|---|---|
| Similarity: | 97/233 - (41%) | Gaps: | 45/233 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 88 LELYDNQITKIE-----NLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENL-- 145
Fly 146 DMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIEN 210
Fly 211 LEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKL---ELLEELWLNHNGVD 272
Fly 273 DWKDIELLKVNKALQTIYLEYNPLAKDV------RYRS 304 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
| LRR_8 | 61..117 | CDD:290566 | 7/33 (21%) | ||
| leucine-rich repeat | 63..84 | CDD:275380 | |||
| LRR_4 | 83..125 | CDD:289563 | 9/41 (22%) | ||
| leucine-rich repeat | 85..106 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 105..183 | CDD:290566 | 24/79 (30%) | ||
| leucine-rich repeat | 107..128 | CDD:275380 | 6/20 (30%) | ||
| LRR_4 | 128..168 | CDD:289563 | 12/41 (29%) | ||
| leucine-rich repeat | 129..150 | CDD:275380 | 5/22 (23%) | ||
| LRR_4 | 149..189 | CDD:289563 | 13/39 (33%) | ||
| leucine-rich repeat | 151..172 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 173..194 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 194..249 | CDD:290566 | 16/54 (30%) | ||
| LRR_4 | 194..235 | CDD:289563 | 10/40 (25%) | ||
| leucine-rich repeat | 195..216 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 217..238 | CDD:275380 | 4/20 (20%) | ||
| R02F11.4 | NP_504289.1 | leucine-rich repeat | 57..78 | CDD:275380 | 4/19 (21%) |
| LRR_RI | <118..245 | CDD:238064 | 39/149 (26%) | ||
| leucine-rich repeat | 122..143 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 143..197 | CDD:290566 | 23/76 (30%) | ||
| leucine-rich repeat | 144..164 | CDD:275380 | 6/20 (30%) | ||
| LRR_4 | 163..205 | CDD:289563 | 16/63 (25%) | ||
| leucine-rich repeat | 165..186 | CDD:275380 | 10/42 (24%) | ||
| leucine-rich repeat | 187..211 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 212..236 | CDD:275380 | 5/23 (22%) | ||
| leucine-rich repeat | 237..256 | CDD:275380 | 4/18 (22%) | ||
| DUF2730 | <480..557 | CDD:287743 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||