DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and DNAAF1

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_011521155.1 Gene:DNAAF1 / 123872 HGNCID:30539 Length:772 Species:Homo sapiens


Alignment Length:206 Identity:74/206 - (35%)
Similarity:105/206 - (50%) Gaps:17/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGK 180
            |:|| .:|.||.|..|:|     ||...|       ..|.|......:|||:|....||.|:|..
Human    87 RMTK-SSLQKLCKQHKLY-----ITPALN-------DTLYLHFKGFDRIENLEEYTGLRCLWLQS 138

  Fly   181 NKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLA 245
            |.|.|||||:....|..|.||.|.:.||||||.|..|..|.:|.|.::||||||....|.||.:|
Human   139 NGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTLQMA 203

  Fly   246 KNRLKGIANLEKLE---LLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDV-RYRSKL 306
            .|.|:.:.:::.|:   .|..|.|:||.:.|.:.:.:|:....|:.:.|..||:.:.: .||..:
Human   204 HNHLETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRTV 268

  Fly   307 RDILPQLQKID 317
            ...|..|..:|
Human   269 TVRLKHLTYLD 279

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380