| Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011516468.1 | Gene: | CNTRL / 11064 | HGNCID: | 1858 | Length: | 2340 | Species: | Homo sapiens |
| Alignment Length: | 271 | Identity: | 79/271 - (29%) |
|---|---|---|---|
| Similarity: | 138/271 - (50%) | Gaps: | 66/271 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 72 LIKKI---ENLSSLKTLIELELYDN---QITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLE 130
Fly 131 KVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNL 195
Fly 196 EILSLQANRIVKIENLEKLANLRE---LYVSENGVETIENLSENT-----KLETLD----LAKNR 248
Fly 249 LKGIA--NLEKLELLEELWLNHNGVDDWKDIELLKVN----KALQTIYLEYNPLAKDVRYRSKLR 307
Fly 308 DILPQ---LQK 315 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
| LRR_8 | 61..117 | CDD:290566 | 20/50 (40%) | ||
| leucine-rich repeat | 63..84 | CDD:275380 | 6/14 (43%) | ||
| LRR_4 | 83..125 | CDD:289563 | 18/44 (41%) | ||
| leucine-rich repeat | 85..106 | CDD:275380 | 7/23 (30%) | ||
| LRR_8 | 105..183 | CDD:290566 | 28/77 (36%) | ||
| leucine-rich repeat | 107..128 | CDD:275380 | 13/20 (65%) | ||
| LRR_4 | 128..168 | CDD:289563 | 12/39 (31%) | ||
| leucine-rich repeat | 129..150 | CDD:275380 | 5/20 (25%) | ||
| LRR_4 | 149..189 | CDD:289563 | 9/39 (23%) | ||
| leucine-rich repeat | 151..172 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 173..194 | CDD:275380 | 4/20 (20%) | ||
| LRR_8 | 194..249 | CDD:290566 | 17/66 (26%) | ||
| LRR_4 | 194..235 | CDD:289563 | 13/43 (30%) | ||
| leucine-rich repeat | 195..216 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 217..238 | CDD:275380 | 7/28 (25%) | ||
| CNTRL | XP_011516468.1 | leucine-rich repeat | 100..119 | CDD:275378 | 4/19 (21%) |
| LRR_4 | 126..167 | CDD:289563 | 19/40 (48%) | ||
| leucine-rich repeat | 127..148 | CDD:275380 | 13/20 (65%) | ||
| LRR_8 | 148..205 | CDD:290566 | 20/76 (26%) | ||
| leucine-rich repeat | 149..170 | CDD:275380 | 5/20 (25%) | ||
| LRR_4 | 169..213 | CDD:289563 | 15/63 (24%) | ||
| leucine-rich repeat | 171..194 | CDD:275380 | 9/42 (21%) | ||
| leucine-rich repeat | 195..219 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 220..246 | CDD:275380 | 6/25 (24%) | ||
| SMC_prok_B | <435..1119 | CDD:274008 | |||
| DUF342 | <513..610 | CDD:302792 | |||
| Pro-rich | <1176..1299 | CDD:291893 | |||
| COG4372 | 1320..>1602 | CDD:226809 | |||
| Mplasa_alph_rch | 1525..2221 | CDD:275316 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||