| Sequence 1: | NP_650619.1 | Gene: | sds22 / 42091 | FlyBaseID: | FBgn0028992 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_663591.3 | Gene: | Lrrc49 / 102747 | MGIID: | 2442689 | Length: | 752 | Species: | Mus musculus |
| Alignment Length: | 244 | Identity: | 74/244 - (30%) |
|---|---|---|---|
| Similarity: | 130/244 - (53%) | Gaps: | 24/244 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 76 IENLSSLKTLI--ELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNR 138
Fly 139 ITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQAN 203
Fly 204 RIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNH 268
Fly 269 NGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID 317 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sds22 | NP_650619.1 | leucine-rich repeat | 43..62 | CDD:275380 | |
| LRR_8 | 61..117 | CDD:290566 | 11/42 (26%) | ||
| leucine-rich repeat | 63..84 | CDD:275380 | 1/7 (14%) | ||
| LRR_4 | 83..125 | CDD:289563 | 10/43 (23%) | ||
| leucine-rich repeat | 85..106 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 105..183 | CDD:290566 | 24/77 (31%) | ||
| leucine-rich repeat | 107..128 | CDD:275380 | 2/20 (10%) | ||
| LRR_4 | 128..168 | CDD:289563 | 13/39 (33%) | ||
| leucine-rich repeat | 129..150 | CDD:275380 | 7/20 (35%) | ||
| LRR_4 | 149..189 | CDD:289563 | 17/39 (44%) | ||
| leucine-rich repeat | 151..172 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 173..194 | CDD:275380 | 13/20 (65%) | ||
| LRR_8 | 194..249 | CDD:290566 | 21/54 (39%) | ||
| LRR_4 | 194..235 | CDD:289563 | 17/40 (43%) | ||
| leucine-rich repeat | 195..216 | CDD:275380 | 10/20 (50%) | ||
| leucine-rich repeat | 217..238 | CDD:275380 | 6/20 (30%) | ||
| Lrrc49 | NP_663591.3 | leucine-rich repeat | 160..177 | CDD:275380 | 4/16 (25%) |
| LRR_4 | 178..219 | CDD:289563 | 16/62 (26%) | ||
| leucine-rich repeat | 180..201 | CDD:275380 | 9/42 (21%) | ||
| LRR_4 | 200..242 | CDD:289563 | 19/41 (46%) | ||
| leucine-rich repeat | 202..223 | CDD:275380 | 7/20 (35%) | ||
| LRR_8 | 222..278 | CDD:290566 | 28/55 (51%) | ||
| LRR_4 | 222..264 | CDD:289563 | 23/41 (56%) | ||
| leucine-rich repeat | 224..245 | CDD:275380 | 13/20 (65%) | ||
| LRR_4 | 244..286 | CDD:289563 | 17/41 (41%) | ||
| leucine-rich repeat | 246..267 | CDD:275380 | 10/20 (50%) | ||
| LRR_8 | 268..322 | CDD:290566 | 15/53 (28%) | ||
| leucine-rich repeat | 268..289 | CDD:275380 | 6/20 (30%) | ||
| LRR_4 | 289..329 | CDD:289563 | 9/39 (23%) | ||
| leucine-rich repeat | 290..311 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 312..336 | CDD:275380 | 5/23 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||