DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sds22 and LRRC23

DIOPT Version :9

Sequence 1:NP_650619.1 Gene:sds22 / 42091 FlyBaseID:FBgn0028992 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001128689.1 Gene:LRRC23 / 10233 HGNCID:19138 Length:343 Species:Homo sapiens


Alignment Length:325 Identity:83/325 - (25%)
Similarity:135/325 - (41%) Gaps:79/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DPDCYELDLNHRRIEKLENFE-------------PLTRIERLFLRWNLIKKIENLSSL-KT---- 84
            |.|..|.:.:.:..|:.|::.             |||.        :::|  |.||.| ||    
Human    13 DQDDSEKEEDEKETEEGEDYRKEGEEFPEEWLPTPLTE--------DMMK--EGLSLLCKTGNGL 67

  Fly    85 ---LIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKL----------------E 130
               .::||:.:..:|.|..|....||..:|||.|.||.:..|:.|..|                |
Human    68 AHAYVKLEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGNRLRSAQMNE 132

  Fly   131 KVY-----FVSNRITQIENLDMLTNLTMLELGDNKLKKIENI--EMLVNLRQLFLGKNKIAKIEN 188
            ..|     |..|:||..|.:.. ..|..|.|..|.:..:..:  |.|::|..:.|..|::.....
Human   133 LPYLQIASFAYNQITDTEGISH-PRLETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQLESTLG 196

  Fly   189 LDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTK-LETLDLAKNRLKGI 252
            :: |..|:.|.|..|.:.|:|.||.|:||..|::.:|.::|:...|...| |:.|:|..|.   :
Human   197 IN-LPKLKNLYLAQNMLKKVEGLEDLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNLRGNM---V 257

  Fly   253 ANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKID 317
            |||.:|..|.:|                   ..|:.:.|..||...:..||.:....:|.|:::|
Human   258 ANLGELAKLRDL-------------------PKLRALVLLDNPCTDETSYRQEALVQMPYLERLD 303

  Fly   318  317
            Human   304  303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sds22NP_650619.1 leucine-rich repeat 43..62 CDD:275380 5/31 (16%)
LRR_8 61..117 CDD:290566 19/63 (30%)
leucine-rich repeat 63..84 CDD:275380 5/21 (24%)
LRR_4 83..125 CDD:289563 16/48 (33%)
leucine-rich repeat 85..106 CDD:275380 5/20 (25%)
LRR_8 105..183 CDD:290566 27/100 (27%)
leucine-rich repeat 107..128 CDD:275380 9/20 (45%)
LRR_4 128..168 CDD:289563 12/62 (19%)
leucine-rich repeat 129..150 CDD:275380 8/41 (20%)
LRR_4 149..189 CDD:289563 9/41 (22%)
leucine-rich repeat 151..172 CDD:275380 6/22 (27%)
leucine-rich repeat 173..194 CDD:275380 4/20 (20%)
LRR_8 194..249 CDD:290566 20/55 (36%)
LRR_4 194..235 CDD:289563 14/40 (35%)
leucine-rich repeat 195..216 CDD:275380 9/20 (45%)
leucine-rich repeat 217..238 CDD:275380 5/20 (25%)
LRRC23NP_001128689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 5/33 (15%)
LRR 1 92..113 9/20 (45%)
leucine-rich repeat 93..114 CDD:275380 9/20 (45%)
LRR 2 114..134 2/19 (11%)
leucine-rich repeat 115..135 CDD:275380 2/19 (11%)
LRR 3 135..155 6/20 (30%)
leucine-rich repeat 136..156 CDD:275380 5/20 (25%)
LRR 4 156..177 4/20 (20%)
leucine-rich repeat 157..180 CDD:275380 6/22 (27%)
LRR 5 180..200 3/20 (15%)
leucine-rich repeat 181..201 CDD:275380 4/20 (20%)
LRR_8 200..255 CDD:290566 19/54 (35%)
LRR_4 200..241 CDD:289563 14/40 (35%)
LRR 6 201..222 8/20 (40%)
leucine-rich repeat 202..223 CDD:275380 9/20 (45%)
LRR_4 223..265 CDD:289563 15/44 (34%)
LRR 7 223..244 6/20 (30%)
leucine-rich repeat 224..246 CDD:275380 5/21 (24%)
LRR 8 246..267 8/23 (35%)
leucine-rich repeat 247..271 CDD:275380 10/45 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54194
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.