DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lute and Abtb2

DIOPT Version :9

Sequence 1:	NP_001262663.1	Gene:	lute / 42089	FlyBaseID:	FBgn0262871	Length:	735	Species:	Drosophila melanogaster
Sequence 2:	NP_849221.2	Gene:	Abtb2 / 99382	MGIID:	2139365	Length:	1024	Species:	Mus musculus

Alignment Length:	144	Identity:	41/144 - (28%)
Similarity:	64/144 - (44%)	Gaps:	23/144 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   207 NNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENKQE--------IKVPD 263
            ||:.||||.|:|.|:.       ..|||.:|.|.|:.|..     |..||.|        |::.|
Mouse   839 NNKEMSDVTFLVEGKL-------FYAHKVLLVTASNRFKT-----LMTNKSEQDGDSSKTIEISD 891

  Fly   264 VEPTAFLTLLRYLY---CDEIKLEPEHILATLYAAKKYIVPHLARACVNYLEVKLTAKNACLLLS 325
            ::...|..|::|||   .:.:::....||..|.||..:.:..|.|.|.......|:.::|.....
Mouse   892 IKYHIFQMLMQYLYYGGTESMEIPTADILQLLSAANLFQLDALQRHCEILCSQTLSVESAVNTYK 956

  Fly   326 QSRLFEEPELMQRC 339
            .:::...|||...|
Mouse   957 YAKIHNAPELALFC 970

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lute	NP_001262663.1	BTB	204..311	CDD:279045	35/114 (31%)
		BTB	213..315	CDD:197585	31/112 (28%)
		BACK	321..427	CDD:197943	4/19 (21%)
		PHR	472..615	CDD:285277
Abtb2	NP_849221.2	H2A	194..>242	CDD:305064
		Ank_4	<498..542	CDD:290365
		ANK	516..670	CDD:238125
		ANK 1	521..550
		ANK repeat	524..565	CDD:293786
		Ank_2	526..633	CDD:289560
		ANK repeat	567..604	CDD:293786
		ANK 2	567..596
		ANK 3	606..635
		ANK repeat	606..631	CDD:293786
		Ank_2	611..>679	CDD:289560
		ANK repeat	649..679	CDD:293786
		ANK 4	649..678
		BTB	836..939	CDD:279045	34/111 (31%)
		BTB	845..946	CDD:197585	31/112 (28%)
		SPOP_C_like	946..>990	CDD:269810	6/25 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167833900
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.840