DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and Btbd17

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_017170266.1 Gene:Btbd17 / 72014 MGIID:1919264 Length:485 Species:Mus musculus


Alignment Length:346 Identity:74/346 - (21%)
Similarity:114/346 - (32%) Gaps:107/346 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IQITQPISAPSSPLASPGALNSSGSSSGGGAGSAGGISGSPTAFCLPSSSAAAAVAAISATPTSG 161
            :..|.|...||:.||              |:...|.:|||  |..||:::..|.|          
Mouse     3 LSATVPPVGPSAVLA--------------GSTRPGALSGS--AMSLPAAAQRADV---------- 41

  Fly   162 SGSYVCSAGTNWHFAAVAASNAIDTADPNWQASKATVLERNAAMFNNELMSDVKFIVGGEFDIDP 226
                          ...||..||:.:....|..:..:.:.||        |||...|.. ...|.
Mouse    42 --------------GGEAAGTAINHSHMLLQRLQDLLRQGNA--------SDVILRVQA-VGTDE 83

  Fly   227 IQTIPAHKYILATGSSVFYAMFYGGLAENKQEIKVPDVEPTA--FLTLLRYLYCDEI-----KLE 284
            ::....|:.:|...|.:|..     |..|:.|:.:.:....|  |...:|||||.|:     :..
Mouse    84 VRAFHTHRLLLGLHSELFRE-----LLSNQSEVMLRESRDCAAVFDKFIRYLYCGELTVLLAQAI 143

  Fly   285 PEHILATLYAAKKYIVPHLARACVNYLEVKL----------------TAKNACLLLSQSRLFEEP 333
            |.|.|||     ||.|..|.|...:|:...|                |...|             
Mouse   144 PLHRLAT-----KYRVASLQRGVADYMRAHLAGGVGPAVGWYHYAVSTGDEA------------- 190

  Fly   334 ELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETLNCK-EIHLFEAALNWAMNACEKMSI 397
             |.:.|.:.:.........|.::..:..:....:|.|..|..: |:.||.|...|...|....::
Mouse   191 -LRESCLQFLAWNLSAVAGSAEWGAVSPELLAQLLQRSDLVLQDELELFHALEAWLGRARPPPTV 254

  Fly   398 DDTPQNKRRLLGQALHLIRIP 418
            .:          :||..||.|
Mouse   255 AE----------RALRAIRYP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 30/113 (27%)
BTB 213..315 CDD:197585 30/108 (28%)
BACK 321..427 CDD:197943 17/99 (17%)
PHR 472..615 CDD:285277
Btbd17XP_017170266.1 BTB_POZ 67..165 CDD:365784 32/116 (28%)
BACK_BTBD17 173..245 CDD:350568 12/85 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.