DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lute and btbd11a

DIOPT Version :9

Sequence 1:	NP_001262663.1	Gene:	lute / 42089	FlyBaseID:	FBgn0262871	Length:	735	Species:	Drosophila melanogaster
Sequence 2:	NP_001314771.1	Gene:	btbd11a / 562893	ZFINID:	ZDB-GENE-050419-142	Length:	1021	Species:	Danio rerio

Alignment Length:	132	Identity:	37/132 - (28%)
Similarity:	59/132 - (44%)	Gaps:	10/132 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   207 NNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENKQEIKVPDVEPTAFLT 271
            ||:.||||.|:|.|:    |..   |||.:|.|.|..|.::.....|.....|::..|:...|..
Zfish   831 NNKEMSDVTFLVEGK----PFY---AHKVLLFTASPRFKSLLSNRPAAENTCIEISHVKYNIFQL 888

  Fly   272 LLRYLYC---DEIKLEPEHILATLYAAKKYIVPHLARACVNYLEVKLTAKNACLLLSQSRLFEEP 333
            :::||||   :.:.:....|:..|.|||.:.:..|.|.|.......:|..:...:...:|.....
Zfish   889 VMQYLYCGGTESLHIRNTEIMELLSAAKFFQLDALQRHCEIICSKNITNDSCVDIYKHARFLGAL 953

  Fly   334 EL 335
            ||
Zfish   954 EL 955

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lute	NP_001262663.1	BTB	204..311	CDD:279045	33/106 (31%)
		BTB	213..315	CDD:197585	29/104 (28%)
		BACK	321..427	CDD:197943	3/15 (20%)
		PHR	472..615	CDD:285277
btbd11a	NP_001314771.1	H2A	190..276	CDD:305064
		ANK	510..663	CDD:238125
		ANK 1. /evidence=ECO:0000255	515..544
		ANK repeat	518..559	CDD:293786
		Ank_2	520..628	CDD:289560
		ANK repeat	561..594	CDD:293786
		ANK 2. /evidence=ECO:0000255	561..590
		ANK repeat	596..624	CDD:293786
		ANK 3. /evidence=ECO:0000255	599..628
		ANK 4. /evidence=ECO:0000255	642..671
		BTB	828..931	CDD:279045	33/106 (31%)
		BTB	837..935	CDD:197585	29/104 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170576649
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930