| Sequence 1: | NP_001262663.1 | Gene: | lute / 42089 | FlyBaseID: | FBgn0262871 | Length: | 735 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_687881.4 | Gene: | abtb2a / 559451 | ZFINID: | ZDB-GENE-100422-13 | Length: | 1006 | Species: | Danio rerio |
| Alignment Length: | 201 | Identity: | 50/201 - (24%) |
|---|---|---|---|
| Similarity: | 87/201 - (43%) | Gaps: | 24/201 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 176 AAVAASNAIDTADPNWQASKAT-VLERNAAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILAT 239
Fly 240 GSSVF---YAMFYGGLAENKQEIKVPDVEPTAFLTLLRYLYC---DEIKLEPEHILATLYAAKKY 298
Fly 299 IVPHLARACVNYLEVKLTAKNACLLLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVD-IDLK 362
Fly 363 TFESIL 368 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| lute | NP_001262663.1 | BTB | 204..311 | CDD:279045 | 27/112 (24%) |
| BTB | 213..315 | CDD:197585 | 23/107 (21%) | ||
| BACK | 321..427 | CDD:197943 | 11/49 (22%) | ||
| PHR | 472..615 | CDD:285277 | |||
| abtb2a | XP_687881.4 | H2A | 187..>235 | CDD:305064 | |
| ANK | 505..655 | CDD:238125 | |||
| ANK repeat | 513..554 | CDD:293786 | |||
| Ank_2 | 515..625 | CDD:289560 | |||
| ANK repeat | 556..590 | CDD:293786 | |||
| ANK repeat | 592..620 | CDD:293786 | |||
| Ank_4 | 598..655 | CDD:290365 | |||
| BTB | 825..928 | CDD:279045 | 26/109 (24%) | ||
| BTB | 834..935 | CDD:197585 | 23/107 (21%) | ||
| SPOP_C_like | 935..986 | CDD:269810 | 13/55 (24%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170576638 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||