DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and KBTBD4

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001305645.1 Gene:KBTBD4 / 55709 HGNCID:23761 Length:567 Species:Homo sapiens


Alignment Length:499 Identity:100/499 - (20%)
Similarity:172/499 - (34%) Gaps:121/499 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PLASPG-----ALNSSGSSSGGGAGSAGGISGSPTAFCLPSSSAAAAVAAISATPTSGSGSYVCS 168
            |:..||     .|..|...|...||..||.|...:.:.......|:     ..:|.....|...:
Human     4 PVPRPGGGWTQVLGRSHRESFERAGKCGGSSSEESKYSWQREKLAS-----MESPEEPGASMDEN 63

  Fly   169 AGTNWHFAAVAASNAIDTADPNWQASKATVLERNAAMFNNELMSDVKFIV-GGEFDIDPIQTIPA 232
            ...|:.|...:.|..:.      |......||       .||.:||...| |.||.:        
Human    64 YFVNYTFKDRSHSGRVA------QGIMKLCLE-------EELFADVTISVEGREFQL-------- 107

  Fly   233 HKYILATGSSVFYAMFYGGLAE-NKQEIKVPDVEPTAFLTLLRYLYCDEIKLEPEHILATLYAAK 296
            |:.:|:..|..|.:||...|.| :.:.|.:.||..:.|..|:.|:|...:||..|.:......:.
Human   108 HRLVLSAQSCFFRSMFTSNLKEAHNRVIVLQDVSESVFQLLVDYIYHGTVKLRAEELQEIYEVSD 172

  Fly   297 KYIVPHLARACVNYLEVKLTAKNACLLLSQSRLFEEPEL---MQRCWEVIDAQAEMAVKSEDFVD 358
            .|.:..|...|..:|...:...|...::..:....:|||   .:.|.:...||.:   .:|:|:.
Human   173 MYQLTSLFEECSRFLARTVQVGNCLQVMWLADRHSDPELYTAAKHCAKTHLAQLQ---NTEEFLH 234

  Fly   359 IDLKTFESILSRETLNCKE--IHLFEAALNWAMNACEKMSIDDTPQNKRRLLGQALHLIRIPTMS 421
            :..:....|:| :.:.|.:  ....||.:|:  |..|:.:..::.:...:.:|:.:|:..|...|
Human   235 LPHRLLTDIIS-DGVPCSQNPTEAIEAWINF--NKEEREAFAESLRTSLKEIGENVHIYLIGKES 296

  Fly   422 LEEFANGVAQTGILSSQETIDMFLHFTAKMKPSLGFPTRSRAGLKTQVCH--------------- 471
                          |...::.:.||.......|:       :| :..:||               
Human   297 --------------SRTHSLAVSLHCAEDDSISV-------SG-QNSLCHQITAACKHGGDLYVV 339

  Fly   472 ------RFQSCAYRSNQWRY-----RGRCDSIQFSVDRR--------------------IFIVGF 505
                  |...|...:..|.:     |.|......||..:                    .:.||.
Human   340 GGSIPRRMWKCNNATVDWEWCAPLPRDRLQHTLVSVPGKDAIYSLGGKTLQDTLSNAVIYYRVGD 404

  Fly   506 GLYGSST-------GAANYNVKIELKRLGRTLAENDTKFFSDGS 542
            .::..:|       |||..|:...:..||.  .|||..||:..|
Human   405 NVWTETTQLEVAVSGAAGANLNGIIYLLGG--EENDLDFFTKPS 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 29/108 (27%)
BTB 213..315 CDD:197585 28/103 (27%)
BACK 321..427 CDD:197943 20/110 (18%)
PHR 472..615 CDD:285277 22/103 (21%)
KBTBD4NP_001305645.1 BTB 88..187 CDD:279045 31/113 (27%)
BTB 95..189 CDD:197585 28/101 (28%)
BACK_like 191..249 CDD:269806 11/61 (18%)
Kelch_2 327..363 CDD:284956 3/35 (9%)
KELCH repeat 328..363 CDD:276965 3/34 (9%)
KELCH repeat 367..414 CDD:276965 6/46 (13%)
mutarot_permut 403..>560 CDD:274642 14/46 (30%)
KELCH repeat 417..463 CDD:276965 12/32 (38%)
KELCH repeat 471..516 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.