DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and RGD1564313

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_003749379.1 Gene:RGD1564313 / 502566 RGDID:1564313 Length:364 Species:Rattus norvegicus


Alignment Length:183 Identity:50/183 - (27%)
Similarity:75/183 - (40%) Gaps:24/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 MFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAEN-KQEIKVPDVEPTA 268
            ::.|.|.:|...:|.|       |...|||.|||..|.||.|||...:.|: ...|::.|:....
  Rat   181 LWENSLFTDCSLVVAG-------QEFRAHKAILAARSPVFRAMFEHEMLESLTNRIEIHDIHLQV 238

  Fly   269 FLTLLRYLYCDEIKLEPEHILAT--LYAAKKYIVPHLARACVNYLEVKLTAKNACLLLSQSRLFE 331
            |..::.::|..:......|.:||  |.||.||.:..|...|.:.|...|:.|||...|..:.|..
  Rat   239 FKEMMAFIYTGKAPHLHSHSMATGLLAAADKYDLQDLKVICEDSLCRNLSVKNAVPTLILADLHS 303

  Fly   332 EPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETLNCKEIHLFEAA 384
            ...|           ..||:   ||:.:........|..:::.....||.|.|
  Rat   304 TEHL-----------KSMAM---DFIILHASEVSETLEWKSMVESHPHLVEEA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 33/108 (31%)
BTB 213..315 CDD:197585 32/104 (31%)
BACK 321..427 CDD:197943 12/64 (19%)
PHR 472..615 CDD:285277
RGD1564313XP_003749379.1 MATH 16..153 CDD:295307
BTB 180..284 CDD:279045 33/109 (30%)
BTB 189..287 CDD:197585 32/104 (31%)
SPOP_C 287..348 CDD:269807 16/70 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.