DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and Tdpoz3

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_997154.2 Gene:Tdpoz3 / 399674 MGIID:3027903 Length:365 Species:Mus musculus


Alignment Length:222 Identity:55/222 - (24%)
Similarity:88/222 - (39%) Gaps:71/222 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 MFNNELMSDVKFIVGG-EFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAEN-KQEIKVPDVEPT 267
            ::.|.|.:|...:|.| ||        .|||.|||..|.||.|||...:.|: |..|::.|::..
Mouse   181 LWENSLFTDCCLLVAGHEF--------KAHKAILAARSPVFRAMFENEMKESLKNPIEIMDLDLD 237

  Fly   268 AFLTLLRYLYCDEIKLEPEHILA--TLYAAKKYIVPHLARACVNYLEVKLTAKNAC--LLLSQSR 328
            .|..::.::|..:......|.:|  .|.||.||.:..|...|.:.|...|:.|.|.  |:|:   
Mouse   238 VFKEMMGFIYTGKAPHLHSHSMACDVLPAADKYGLVGLKVLCEDVLCRNLSVKTAAHTLILA--- 299

  Fly   329 LFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETLNCKEIHLFEAALNW-AMNAC 392
                                           ||.:.|.:.|:             ||:: |::||
Mouse   300 -------------------------------DLNSTEKLKSQ-------------ALDFIAIHAC 320

  Fly   393 EKMSIDDTPQNKR------RLLGQALH 413
            |   :.:|.:.|.      .|:.:|.|
Mouse   321 E---VSETSEWKSMWKSHPHLVAEAFH 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 34/109 (31%)
BTB 213..315 CDD:197585 33/105 (31%)
BACK 321..427 CDD:197943 17/102 (17%)
PHR 472..615 CDD:285277
Tdpoz3NP_997154.2 MATH 17..153 CDD:295307
BTB 178..284 CDD:279045 34/110 (31%)
BTB 189..287 CDD:197585 33/105 (31%)
SPOP_C 287..349 CDD:269807 20/108 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.