DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and BTBD17

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_011523093.1 Gene:BTBD17 / 388419 HGNCID:33758 Length:479 Species:Homo sapiens


Alignment Length:310 Identity:68/310 - (21%)
Similarity:106/310 - (34%) Gaps:83/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 GSPTAFCLPSSS--AAAAVAAISATPTSGSGSYVCSAGTNWHFAAVAASNAIDTADPNWQASKAT 197
            |:|..||....:  ..|.:|.:.|......|.   :|||:.:.:               ||    
Human     7 GAPRLFCREPETFQGEARLALLGAQRADVGGE---AAGTSINHS---------------QA---- 49

  Fly   198 VLERNAAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENKQEIKVP 262
            ||:|...:......|||...|... ..|.::...||:.:|...|.:|..     |..|:.|..:.
Human    50 VLQRLQELLRQGNASDVVLRVQAA-GTDEVRVFHAHRLLLGLHSELFLE-----LLSNQSEAVLQ 108

  Fly   263 DVEPTA--FLTLLRYLYCDEI-----KLEPEHILATLYAAKKYIVPHLARACVNYLEVKL----- 315
            :.:..|  |...:|||||.|:     :..|.|.|||     ||.|..|.|...:|:...|     
Human   109 EPQDCAAVFDKFIRYLYCGELTVLLTQAIPLHRLAT-----KYGVSSLQRGVADYMRAHLAGGAG 168

  Fly   316 -----------TAKNACLLLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILS 369
                       |...|              |.:.|.:.:.........|.::..:..:....:|.
Human   169 PAVGWYHYAVGTGDEA--------------LRESCLQFLAWNLSAVAASTEWGAVSPELLWQLLQ 219

  Fly   370 RETLNCK-EIHLFEAALNWAMNACEKMSIDDTPQNKRRLLGQALHLIRIP 418
            |..|..: |:.||.|...|...|....::.:          :||..||.|
Human   220 RSDLVLQDELELFHALEAWLGRARPPPAVAE----------RALRAIRYP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 31/113 (27%)
BTB 213..315 CDD:197585 31/108 (29%)
BACK 321..427 CDD:197943 17/99 (17%)
PHR 472..615 CDD:285277
BTBD17XP_011523093.1 BTB 54..159 CDD:279045 31/115 (27%)
BTB 65..163 CDD:197585 31/108 (29%)
BACK 170..268 CDD:197943 19/114 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.