DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and CG11714

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster


Alignment Length:334 Identity:73/334 - (21%)
Similarity:117/334 - (35%) Gaps:101/334 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 SDVKFIV----GGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENKQ-EIKVPDVEPTAFLT 271
            :|..||:    ||.      |:.|.||.:.:..|.||..|.||...|:.. .:::.||:|..|..
  Fly    28 TDCTFIIEDESGGS------QSFPCHKLLFSCASDVFDRMLYGDYIESTSGVVRLNDVQPDIFEK 86

  Fly   272 LLRYLY---CDEI-KLEPEHILATLYAAKKYIVPHLARACVNYLEVKLTAKNACLLLSQSRLFEE 332
            ...|:|   ||:: |.:.:.::.....|.||:|..|...||..|   |..||...:....|||:.
  Fly    87 FRDYVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEEDCVKDL---LIR
KNTFDMGELLRLFQC 148

  Fly   333 PELMQR-------CWEV-------IDAQAEMAVKSEDFVDIDLKTFESILSRETLNCKEIHLFEA 383
            ...|.|       .||:       :|.........|.|     |.:..:::.:........|.|.
  Fly   149 AHRMNRKSLINQIAWELKCTFKSTLDHSGVYEFNCEVF-----KHYIEVIASKISEADRFRLLEM 208

  Fly   384 ALNWAMNACEKM-------SIDDT------------------------------------PQNKR 405
            .|.:  |..|::       |.|.|                                    |..|.
  Fly   209 YLKY--NGIEELESAGQVDSQDATEANTTTITTTNEVENQESELPSTSCVPLKTECSFAVPNKKA 271

  Fly   406 RLLGQALHLIRIPTMSLEEFANGVAQTGILS-----------------SQETIDMFLHFTAKMKP 453
            ..:...|.||....:|.:||.:|..::..||                 :::.:.:.:..|.:.||
  Fly   272 SFVSDLLALIDFGKLSPKEFYDGPGKSNFLSLAEKYEHMYQIAKNCVTAKDELQLKMALTTEQKP 336

  Fly   454 SLGFPTRSR 462
            .|  |:.||
  Fly   337 PL--PSESR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 32/107 (30%)
BTB 213..315 CDD:197585 33/110 (30%)
BACK 321..427 CDD:197943 27/162 (17%)
PHR 472..615 CDD:285277
CG11714NP_001027123.1 BTB 27..131 CDD:279045 33/111 (30%)
BTB 29..133 CDD:197585 34/112 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.