DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and CG11275

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_611649.1 Gene:CG11275 / 37534 FlyBaseID:FBgn0034706 Length:417 Species:Drosophila melanogaster


Alignment Length:228 Identity:53/228 - (23%)
Similarity:96/228 - (42%) Gaps:25/228 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 NAIDTADPNWQASKATVLERNAAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYA 246
            :|:|..:|.  :..:.:..|...:......:|..|.|..|       .:..||.||::.|.||.|
  Fly     4 SAVDRKEPG--SVSSGLGRRYGQLLRGAKYTDCVFHVCEE-------QVKCHKLILSSASPVFEA 59

  Fly   247 MFYGGLAEN--KQEIKVPDVEPTAFLTLLRYLYCDEIKLEPEHILATL---YAAKKYIVPHLARA 306
            ||:|.:..|  :.||::.|:....|..|:.|:|...:......::|.:   |||:||::..|...
  Fly    60 MFFGPMQNNEPEPEIEIHDISSAIFKVLVEYIYTGVVDYNGLELVACIELYYAAEKYLLEELIAD 124

  Fly   307 CVNYLEVKLTAKNACLLLSQSRLFEEPELMQRCWE-----VIDAQAEMAVKSEDFVDIDLKTFES 366
            .:..:..||...|....|..|.......|::.|..     .::....|:...|.:|.:..:..::
  Fly   125 TLMVITRKLRFANILPALELSVCMGLDGLLEVCMTFFMRCCVNNGQYMSHLKEHYVHVSKECVKA 189

  Fly   367 ILSRETLNCKEIH--LFEAALNWAMNACEKMSI 397
            |::.    |||.|  |......|....||::.:
  Fly   190 IIAA----CKEPHKLLIWYVYEWTRQECEQLGL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 30/111 (27%)
BTB 213..315 CDD:197585 30/106 (28%)
BACK 321..427 CDD:197943 16/84 (19%)
PHR 472..615 CDD:285277
CG11275NP_611649.1 BTB 22..122 CDD:279045 29/106 (27%)
BTB 33..122 CDD:197585 29/95 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.