DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and klhl11

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_956077.1 Gene:klhl11 / 327313 ZFINID:ZDB-GENE-030131-5524 Length:679 Species:Danio rerio


Alignment Length:196 Identity:37/196 - (18%)
Similarity:90/196 - (45%) Gaps:19/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 AHKYILATGSSVFYAMFYGGLAEN-KQEIKVPDVEPTAFL------TLLRYLYCDEIKLEPEHIL 289
            ||:.:||..:..|..:..|..:|: .:.:::.:....|.|      ::::::|..||::...::.
Zfish    79 AHRSVLAAATDYFTPLLGGQFSESVTRRVEMKEWSSEAGLDQETVESVIQFMYTGEIRVSTANVH 143

  Fly   290 ATLYAAKKYIVPHLARACVNYLEVKLTAKNACLLLSQSRLFEEPELMQRCWEVIDAQAEMAVKSE 354
            ..|..|.::::..|...|..:|:.||:..|...:.|.:.::...:|..|..::|.......::.|
Zfish   144 EVLELADRFLLVQLKDFCGEFLKRKLSLGNCVAIHSLAHMYTLDQLALRAVDMIRRNFHKVIQDE 208

  Fly   355 DFVDIDLKTFESILS--RETLNCKEIHLFEAALNWAMNACEKMSIDDTPQNKRRLLGQALHLIRI 417
            :|..:..:.....||  ..|::.:|: ||:|.:.|         :....:.:.:...:...|:|:
Zfish   209 EFYTLPFRLVRDWLSDAEITVDSEEV-LFDAVVKW---------VQKNSEERVKYFEELFRLLRL 263

  Fly   418 P 418
            |
Zfish   264 P 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 16/85 (19%)
BTB 213..315 CDD:197585 17/89 (19%)
BACK 321..427 CDD:197943 17/100 (17%)
PHR 472..615 CDD:285277
klhl11NP_956077.1 BTB 50..166 CDD:279045 16/86 (19%)
PHA03098 54..541 CDD:222983 37/196 (19%)
BACK 174..276 CDD:285009 17/101 (17%)
Kelch_1 369..410 CDD:279660
KELCH repeat 369..409 CDD:276965
Kelch_1 412..456 CDD:279660
KELCH repeat 413..458 CDD:276965
KELCH repeat 461..511 CDD:276965
KELCH repeat 572..618 CDD:276965
Kelch 582..628 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.