Sequence 1: | NP_001262663.1 | Gene: | lute / 42089 | FlyBaseID: | FBgn0262871 | Length: | 735 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956077.1 | Gene: | klhl11 / 327313 | ZFINID: | ZDB-GENE-030131-5524 | Length: | 679 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 37/196 - (18%) |
---|---|---|---|
Similarity: | 90/196 - (45%) | Gaps: | 19/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 232 AHKYILATGSSVFYAMFYGGLAEN-KQEIKVPDVEPTAFL------TLLRYLYCDEIKLEPEHIL 289
Fly 290 ATLYAAKKYIVPHLARACVNYLEVKLTAKNACLLLSQSRLFEEPELMQRCWEVIDAQAEMAVKSE 354
Fly 355 DFVDIDLKTFESILS--RETLNCKEIHLFEAALNWAMNACEKMSIDDTPQNKRRLLGQALHLIRI 417
Fly 418 P 418 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lute | NP_001262663.1 | BTB | 204..311 | CDD:279045 | 16/85 (19%) |
BTB | 213..315 | CDD:197585 | 17/89 (19%) | ||
BACK | 321..427 | CDD:197943 | 17/100 (17%) | ||
PHR | 472..615 | CDD:285277 | |||
klhl11 | NP_956077.1 | BTB | 50..166 | CDD:279045 | 16/86 (19%) |
PHA03098 | 54..541 | CDD:222983 | 37/196 (19%) | ||
BACK | 174..276 | CDD:285009 | 17/101 (17%) | ||
Kelch_1 | 369..410 | CDD:279660 | |||
KELCH repeat | 369..409 | CDD:276965 | |||
Kelch_1 | 412..456 | CDD:279660 | |||
KELCH repeat | 413..458 | CDD:276965 | |||
KELCH repeat | 461..511 | CDD:276965 | |||
KELCH repeat | 572..618 | CDD:276965 | |||
Kelch | 582..628 | CDD:128874 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170576644 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |