DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and BTBD9

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster


Alignment Length:245 Identity:74/245 - (30%)
Similarity:114/245 - (46%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 AAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENKQEIKVP-DVEP 266
            |.:..||..:||:|||..|       .||||:.|||..|..|.|:.|||:||..|. ::| :|..
  Fly    37 ARLCMNEQYADVEFIVEEE-------RIPAHRVILAARSEYFRALLYGGMAETTQR-QIPLEVPL 93

  Fly   267 TAFLTLLRYLYCDEI---KLEPEHILATLYAAKKYIVPHLARACVNYLEVKLTAKNACLLLSQSR 328
            .||..||||:|...:   .|:.:..:..|..|.:|....|..|..|||...|...|.|::|..:|
  Fly    94 EAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAAR 158

  Fly   329 LFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETLNCKEIHLFEAALNWA-MNAC 392
            |:...||.:.|...:|..|...:....|..:..::.|.:|.|:.....|:.:|.|...|: .|: 
  Fly   159 LYNLEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSRFNS- 222

  Fly   393 EKMSIDDTPQNKRRLLGQALHLIRIPTMSLEEFANGVAQTGILSSQETID 442
               ::|         ....:..:|:|.|:||.....|..:|||...:.:|
  Fly   223 ---NVD---------FKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 40/110 (36%)
BTB 213..315 CDD:197585 40/105 (38%)
BACK 321..427 CDD:197943 24/106 (23%)
PHR 472..615 CDD:285277
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 40/106 (38%)
BTB 47..145 CDD:197585 40/105 (38%)
BACK_BTBD9_like 145..203 CDD:269811 15/57 (26%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D38146at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.