DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and RGD1566337

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_003749378.2 Gene:RGD1566337 / 310589 RGDID:1566337 Length:364 Species:Rattus norvegicus


Alignment Length:208 Identity:53/208 - (25%)
Similarity:84/208 - (40%) Gaps:33/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 MFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAEN-KQEIKVPDVEPTA 268
            ::.|.:.:|...:|.|       |...|||.|||..|.||.|||...:.|: ...|::.|:....
  Rat   181 LWENFIFTDCSLVVAG-------QEFRAHKAILAARSPVFRAMFEHEMLESLTNRIEIHDIHLHV 238

  Fly   269 FLTLLRYLYCDEIKLEPEHILAT--LYAAKKYIVPHLARACVNYLEVKLTAKNA--CLLLSQSRL 329
            |..::.::|..:......|.:||  |.||..|.:..|...|.:.|...|:.:||  .|:|:.   
  Rat   239 FKEMMGFIYTGKAPHLHSHSMATRLLAAADMYDLQDLKVMCEDALCRNLSVENAVSTLILAD--- 300

  Fly   330 FEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETLNCKEIHLFEAAL-NWAMNACE 393
            |...|             .:..|:.||:.:........|..:::.....||.|.|. :.|...|.
  Rat   301 FHSTE-------------HLKTKAMDFIILHASEVSETLGWKSMVESHPHLVEEAFRSLASIQCP 352

  Fly   394 KMSIDDTPQNKRR 406
            .:.    |..|||
  Rat   353 FLE----PSLKRR 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 31/108 (29%)
BTB 213..315 CDD:197585 31/104 (30%)
BACK 321..427 CDD:197943 18/87 (21%)
PHR 472..615 CDD:285277
RGD1566337XP_003749378.2 MATH 16..153 CDD:351761
BTB_POZ 165..292 CDD:365784 33/117 (28%)
BACK 287..353 CDD:421692 17/81 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.