DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and Btbd9

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001013091.1 Gene:Btbd9 / 294318 RGDID:1306975 Length:612 Species:Rattus norvegicus


Alignment Length:406 Identity:102/406 - (25%)
Similarity:155/406 - (38%) Gaps:92/406 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 ERNAAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENKQEIKVP-- 262
            |...|:...|...||.|:|       ..:..|||:.|||.....|.|:.|||:.|::.|.::|  
  Rat    24 EHIGALLIGEEYGDVTFVV-------EKKRFPAHRVILAARCQYFRALLYGGMRESQPEAEIPLQ 81

  Fly   263 DVEPTAFLTLLRYLYCDEIKL--EPEHILAT-LYAAKKYIVPHLARACVNYLEVKLTAKNACLLL 324
            |....||..||||:|.....|  |.|.:|.. |..|.||..|.|..:...||...|..:|.|:..
  Rat    82 DTTAEAFTMLLRYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILNIQNVCMTF 146

  Fly   325 SQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETLNCKEIHLFEAALNWAM 389
            ..:.|:..|:|...|...:|..|:..:.|:.|:.:......:|:.|::....|..:|.|.|||  
  Rat   147 DVASLYSLPKLTCMCCMFMDRNAQEVLASDGFLSLSKTALLNIVLRDSFAAPEKDIFLALLNW-- 209

  Fly   390 NACEKMSIDDTPQNKRRLLGQALHLIRIPTMSLEEFANGVAQTGILSSQETIDMFLHFTAKMKPS 454
              |:        .|.:....:.:..:|:|.|||.|..|.|..:|:||....:|            
  Rat   210 --CK--------HNAKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILD------------ 252

  Fly   455 LGFPTRSRAGLKTQVCHRFQSCAYRSNQWRYRGRCDSIQFSVDRRIFIVGFGLYGSSTGAANYNV 519
             ....||.:               |.....|||     ....:..|..:   .||:..      |
  Rat   253 -AIKVRSES---------------RDMDLNYRG-----MLIPEENIATM---KYGAQV------V 287

  Fly   520 KIELKRLGRTLAENDTKFFSDGSSNTFHVFFENPIQIEPECYYTASVIL---------------- 568
            |.|||   ..|.:.||:.:     :..|.|..:|  |:.:|.....:.|                
  Rat   288 KGELK---SALLDGDTQNY-----DLDHGFSRHP--IDDDCRSGIEIKLGQPSIINHIRLLLWDR 342

  Fly   569 DGNELSFFGQEGMSEV 584
            |....|:|.:..|.|:
  Rat   343 DSRSYSYFIEVSMDEL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 38/111 (34%)
BTB 213..315 CDD:197585 38/106 (36%)
BACK 321..427 CDD:197943 25/105 (24%)
PHR 472..615 CDD:285277 26/129 (20%)
Btbd9NP_001013091.1 BTB 33..134 CDD:279045 38/107 (36%)
BTB 37..137 CDD:197585 38/106 (36%)
BACK_BTBD9_like 137..196 CDD:269811 13/58 (22%)
F5_F8_type_C 292..405 CDD:279139 15/77 (19%)
F5_F8_type_C 445..546 CDD:279139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..612
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.