DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and Spop

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001093966.1 Gene:Spop / 287643 RGDID:1311613 Length:374 Species:Rattus norvegicus


Alignment Length:147 Identity:42/147 - (28%)
Similarity:68/147 - (46%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 MFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENKQ-EIKVPDVEPTA 268
            ::.|...:|....|.|       |...|||.|||..|.||.|||...:.|:|: .:::.||||..
  Rat   193 LWENSRFTDCCLCVAG-------QEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEV 250

  Fly   269 FLTLLRYLY---CDEIKLEPEHILATLYAAKKYIVPHLARACVNYLEVKLTAKNACLLLSQSRLF 330
            |..::.::|   ...:....:.:||   ||.||.:..|...|.:.|...|:.:||..:|..:.|.
  Rat   251 FKEMMCFIYTGKAPNLDKMADDLLA---AADKYALERLKVMCEDALCSNLSVENAAEILILADLH 312

  Fly   331 EEPELMQRCWEVIDAQA 347
            ...:|..:..:.|:..|
  Rat   313 SADQLKTQAVDFINYHA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 33/109 (30%)
BTB 213..315 CDD:197585 33/105 (31%)
BACK 321..427 CDD:197943 5/27 (19%)
PHR 472..615 CDD:285277
SpopNP_001093966.1 MATH_SPOP 28..166 CDD:239743
BTB_POZ_SPOP-like 182..301 CDD:349588 35/117 (30%)
BACK_SPOP 297..367 CDD:350593 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.