DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and Tdpoz8

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001171165.1 Gene:Tdpoz8 / 229571 MGIID:3645677 Length:370 Species:Mus musculus


Alignment Length:188 Identity:43/188 - (22%)
Similarity:83/188 - (44%) Gaps:46/188 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 MFNNELMSDVKFIVGG-EFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENKQEIK------VP 262
            ::.|.|.:|...:|.| ||        .|||.|||..|.||.|||     |::.:::      :.
Mouse   181 LWENSLFTDCCLLVAGHEF--------RAHKVILAARSPVFRAMF-----EHEMKVRLTNRVEIH 232

  Fly   263 DVEPTAFLTLLRYLYCDEIKLEPEHILAT--LYAAKKYIVPHLARACVNYLEVKLTAKNAC--LL 323
            |::|..|..::.::|..:......:.:|:  |.||.:..:..|...|.:.|...|:.:||.  |:
Mouse   233 DLDPQVFKEMMGFIYTGKASHLHSYSMASDVLAAADRCGLKGLKVMCEDALCRNLSVENAAHTLI 297

  Fly   324 LSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRET--LNCKEIH 379
            |:.....|                .:.:::.||:.:    :.|.:|:.:  ::.:|.|
Mouse   298 LADLHSIE----------------HLKIQALDFITV----YASEVSKTSGWMSMRESH 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 30/114 (26%)
BTB 213..315 CDD:197585 29/110 (26%)
BACK 321..427 CDD:197943 9/63 (14%)
PHR 472..615 CDD:285277
Tdpoz8NP_001171165.1 MATH 16..154 CDD:295307
BTB 180..284 CDD:279045 30/115 (26%)
BTB 189..287 CDD:197585 29/110 (26%)
SPOP_C 287..348 CDD:269807 12/69 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.