DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and BTBD9

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001092742.1 Gene:BTBD9 / 114781 HGNCID:21228 Length:612 Species:Homo sapiens


Alignment Length:419 Identity:108/419 - (25%)
Similarity:161/419 - (38%) Gaps:90/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 ERNAAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENKQEIKVP-- 262
            |...|:...|...||.|:|       ..:..|||:.|||.....|.|:.|||:.|::.|.::|  
Human    24 EHIGALLIGEEYGDVTFVV-------EKKRFPAHRVILAARCQYFRALLYGGMRESQPEAEIPLQ 81

  Fly   263 DVEPTAFLTLLRYLYCDEIKL--EPEHILAT-LYAAKKYIVPHLARACVNYLEVKLTAKNACLLL 324
            |....||..||:|:|.....|  |.|.:|.. |..|.||..|.|..:...||...|..:|.|:..
Human    82 DTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILNIQNVCMTF 146

  Fly   325 SQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETLNCKEIHLFEAALNWAM 389
            ..:.|:..|:|...|...:|..|:..:.||.|:.:......:|:.|::....|..:|.|.|||  
Human   147 DVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLSLSKTALLNIVLRDSFAAPEKDIFLALLNW-- 209

  Fly   390 NACEKMSIDDTPQNKRRLLGQALHLIRIPTMSLEEFANGVAQTGILSSQETIDMFLHFTAKMKPS 454
              |:        .|.:....:.:..:|:|.|||.|..|.|..:|:||....:|            
Human   210 --CK--------HNSKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILD------------ 252

  Fly   455 LGFPTRSRAGLKTQVCHRFQSCAYRSNQWRYRGRCDSIQFSVDRRIFIVGFGLYGSSTGAANYNV 519
             ....||.:               |.....|||     ....:..|..:   .||:..      |
Human   253 -AIKVRSES---------------RDMDLNYRG-----MLIPEENIATM---KYGAQV------V 287

  Fly   520 KIELKRLGRTLAENDTKFFSDGSSNTFHVFFENPIQ------IE-----PECYYTASVIL---DG 570
            |.|||   ..|.:.||:.:     :..|.|..:||.      ||     |.......::|   |.
Human   288 KGELK---SALLDGDTQNY-----DLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDS 344

  Fly   571 NELSFFGQEGMSEVLMGNVT--FQFQCSS 597
            ...|:|.:..|.|:....|.  .|:.|.|
Human   345 RSYSYFIEVSMDELDWVRVIDHSQYLCRS 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 37/111 (33%)
BTB 213..315 CDD:197585 37/106 (35%)
BACK 321..427 CDD:197943 26/105 (25%)
PHR 472..615 CDD:285277 32/142 (23%)
BTBD9NP_001092742.1 BTB_POZ_BTBD9 14..133 CDD:349596 38/115 (33%)
BACK_BTBD9 137..235 CDD:350518 27/109 (25%)
F5_F8_type_C 292..405 CDD:366285 21/90 (23%)
F5_F8_type_C 445..546 CDD:366285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..612
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.