DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and Spopfm2

DIOPT Version :10

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001139579.1 Gene:Spopfm2 / 100043188 MGIID:3702972 Length:357 Species:Mus musculus


Alignment Length:209 Identity:50/209 - (23%)
Similarity:84/209 - (40%) Gaps:39/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 MFNNELMSD-VKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAEN-KQEIKVPDVEPT 267
            ::.|.|.:| ..|:.|.||        .|||.|||..|.||.|||...:.|. ...:.:.|::|.
Mouse   181 LWENSLCTDCCLFVAGQEF--------RAHKAILAARSPVFRAMFEHEMVERLTNRVDINDLDPK 237

  Fly   268 AFLTLLRYLYCDEIKLEPEHILA--TLYAAKKYIVPHLARACVNYLEVKLTAKNACLLLSQSRLF 330
            .|..::.::|..:......|.:|  .|.||.:|.:..|...|.:.|...|:.:||...|..:.|.
Mouse   238 VFKEMMGFIYTGKAPHLHIHSMACDLLAAADRYGMEGLMVLCEDALSRNLSVENAAHTLILADLH 302

  Fly   331 EEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETLNCKEIHLFEAALNWAMNACEKM 395
            ...:|..:..:.|...|....::.:        ::|::....      ||...|.::..:|    
Mouse   303 STQQLKTQALDFIALHASKVCETSE--------WKSMVESNP------HLVAEAFHFLASA---- 349

  Fly   396 SIDDTPQNKRRLLG 409
                     ||.||
Mouse   350 ---------RRFLG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB_POZ_BTBD3_6 205..315 CDD:349591 33/113 (29%)
BACK_BTBD3_like 315..409 CDD:350563 15/93 (16%)
PHR 471..616 CDD:462339
Spopfm2NP_001139579.1 MATH 16..153 CDD:445786
BTB_POZ 165..292 CDD:453885 34/118 (29%)
BACK 287..351 CDD:475122 13/90 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.