DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and btbd11b

DIOPT Version :10

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001410977.1 Gene:btbd11b / 100034519 ZFINID:ZDB-GENE-050419-99 Length:1012 Species:Danio rerio


Alignment Length:208 Identity:56/208 - (26%)
Similarity:90/208 - (43%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 KATVLERNAA------MFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLA 253
            |.|.::|...      ..||:.||||.|:|.|:    |..   |||.:|.|.|:.|..:.....|
Zfish   808 KLTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGK----PFY---AHKVLLFTASNRFKLLLANRPA 865

  Fly   254 ENKQEIKVPDVEPTAFLTLLRYLYC---DEIKLEPEHILATLYAAKKYIVPHLARACVNYLEVKL 315
            .....|::..|:...|..:::||||   |.:.:....::..|.|:|.:.:..|.|.|    |: :
Zfish   866 AENTCIEISHVKYNVFQLVMQYLYCGGTDALHIRNTEVMDLLSASKFFQLEALQRHC----EI-I 925

  Fly   316 TAKN----ACL-LLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETL-N 374
            .|||    .|: :.:.::..|.|||        .|..|........|.|:|:.|:.:|....: |
Zfish   926 CAKNINTETCVEIYNHAKFLEAPEL--------SAYIEGYFLKNMAVLIELEPFKQLLYNTPVEN 982

  Fly   375 C--KEIHLFEAAL 385
            |  ..:|..|..|
Zfish   983 CCPDVLHDLEKTL 995

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB_POZ_BTBD3_6 205..315 CDD:349591 33/112 (29%)
BACK_BTBD3_like 315..409 CDD:350563 20/79 (25%)
PHR 471..616 CDD:462339
btbd11bNP_001410977.1 HFD_ABTB2-like 182..289 CDD:467038
ANKYR <505..704 CDD:440430
ANK 1. /evidence=ECO:0000255 511..540
ANK repeat 514..555 CDD:293786
ANK repeat 557..590 CDD:293786
ANK 2. /evidence=ECO:0000255 557..586
ANK repeat 592..620 CDD:293786
ANK 3. /evidence=ECO:0000255 595..624
ANK repeat 630..668 CDD:293786
BTB_POZ 807..937 CDD:453885 40/140 (29%)
BACK 930..1012 CDD:475122 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.