Sequence 1: | NP_001262663.1 | Gene: | lute / 42089 | FlyBaseID: | FBgn0262871 | Length: | 735 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003200483.1 | Gene: | btbd11b / 100034519 | ZFINID: | ZDB-GENE-050419-99 | Length: | 1012 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 56/208 - (26%) |
---|---|---|---|
Similarity: | 90/208 - (43%) | Gaps: | 37/208 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 195 KATVLERNAA------MFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLA 253
Fly 254 ENKQEIKVPDVEPTAFLTLLRYLYC---DEIKLEPEHILATLYAAKKYIVPHLARACVNYLEVKL 315
Fly 316 TAKN----ACL-LLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETL-N 374
Fly 375 C--KEIHLFEAAL 385 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lute | NP_001262663.1 | BTB | 204..311 | CDD:279045 | 32/115 (28%) |
BTB | 213..315 | CDD:197585 | 29/104 (28%) | ||
BACK | 321..427 | CDD:197943 | 17/69 (25%) | ||
PHR | 472..615 | CDD:285277 | |||
btbd11b | XP_003200483.1 | H2A | 189..275 | CDD:305064 | |
ANK | 506..659 | CDD:238125 | |||
ANK repeat | 514..555 | CDD:293786 | |||
Ank_2 | 516..622 | CDD:289560 | |||
ANK repeat | 557..590 | CDD:293786 | |||
ANK repeat | 592..620 | CDD:293786 | |||
ANK repeat | 630..668 | CDD:293786 | |||
BTB | 823..926 | CDD:279045 | 33/114 (29%) | ||
BTB | 832..930 | CDD:197585 | 31/109 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170576650 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |