DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and btbd11b

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_003200483.1 Gene:btbd11b / 100034519 ZFINID:ZDB-GENE-050419-99 Length:1012 Species:Danio rerio


Alignment Length:208 Identity:56/208 - (26%)
Similarity:90/208 - (43%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 KATVLERNAA------MFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLA 253
            |.|.::|...      ..||:.||||.|:|.|:    |..   |||.:|.|.|:.|..:.....|
Zfish   808 KLTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGK----PFY---AHKVLLFTASNRFKLLLANRPA 865

  Fly   254 ENKQEIKVPDVEPTAFLTLLRYLYC---DEIKLEPEHILATLYAAKKYIVPHLARACVNYLEVKL 315
            .....|::..|:...|..:::||||   |.:.:....::..|.|:|.:.:..|.|.|    |: :
Zfish   866 AENTCIEISHVKYNVFQLVMQYLYCGGTDALHIRNTEVMDLLSASKFFQLEALQRHC----EI-I 925

  Fly   316 TAKN----ACL-LLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETL-N 374
            .|||    .|: :.:.::..|.|||        .|..|........|.|:|:.|:.:|....: |
Zfish   926 CAKNINTETCVEIYNHAKFLEAPEL--------SAYIEGYFLKNMAVLIELEPFKQLLYNTPVEN 982

  Fly   375 C--KEIHLFEAAL 385
            |  ..:|..|..|
Zfish   983 CCPDVLHDLEKTL 995

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 32/115 (28%)
BTB 213..315 CDD:197585 29/104 (28%)
BACK 321..427 CDD:197943 17/69 (25%)
PHR 472..615 CDD:285277
btbd11bXP_003200483.1 H2A 189..275 CDD:305064
ANK 506..659 CDD:238125
ANK repeat 514..555 CDD:293786
Ank_2 516..622 CDD:289560
ANK repeat 557..590 CDD:293786
ANK repeat 592..620 CDD:293786
ANK repeat 630..668 CDD:293786
BTB 823..926 CDD:279045 33/114 (29%)
BTB 832..930 CDD:197585 31/109 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.