DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lute and abtb2b

DIOPT Version :9

Sequence 1:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_001923186.1 Gene:abtb2b / 100007078 ZFINID:ZDB-GENE-100422-14 Length:1032 Species:Danio rerio


Alignment Length:157 Identity:43/157 - (27%)
Similarity:71/157 - (45%) Gaps:40/157 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 VLERNAAM--------FNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAE 254
            :.|:.||:        .||:.||||.|:|.|:    |..   ||..:|.|.|..|..:    ||:
Zfish   828 IQEKKAALAAQLDPHFLNNQEMSDVTFLVEGK----PFY---AHGVLLLTASDRFKTL----LAQ 881

  Fly   255 N-------KQEIKVPDVEPTAFLTLLRYLYC---DEIKLEPEHILATLYAAKKYIVPHLARACV- 308
            |       :::|::.:::...|..::.||||   :.:|:....:|..|.||..:.:..|.|.|. 
Zfish   882 NGSDSTQTRKDIEISNIKYNIFQMMMSYLYCGGTESLKMGVSELLELLSAASLFQLGVLQRHCEI 946

  Fly   309 ---------NYLEVKLTAK-NACLLLS 325
                     |.:.:..||| |..:.||
Zfish   947 LCAQNIDLDNAVNIYHTAKANGAVELS 973

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
luteNP_001262663.1 BTB 204..311 CDD:279045 35/134 (26%)
BTB 213..315 CDD:197585 30/121 (25%)
BACK 321..427 CDD:197943 2/5 (40%)
PHR 472..615 CDD:285277
abtb2bXP_001923186.1 Histone <131..178 CDD:329110
H2A 181..>235 CDD:330514
ANK 506..660 CDD:238125
ANK repeat 514..555 CDD:293786
ANK repeat 557..594 CDD:293786
ANK repeat 596..626 CDD:293786
BTB 842..952 CDD:306997 33/120 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.