DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brf and SUA7

DIOPT Version :9

Sequence 1:NP_001163636.1 Gene:Brf / 42087 FlyBaseID:FBgn0038499 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_015411.1 Gene:SUA7 / 856201 SGDID:S000006290 Length:345 Species:Saccharomyces cerevisiae


Alignment Length:298 Identity:64/298 - (21%)
Similarity:115/298 - (38%) Gaps:49/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKCRNCG--SNEIEEDNARGDRVCMNCGSVLEDSLIVSEVQF------EEVGHGAAAIGQFVSAE 61
            |.|..|.  ..:|.|..:.||.||..||.||.|.|:.:..::      :..|...:.:|:..:..
Yeast    22 LTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPL 86

  Fly    62 SSGGATNYGYGKFQVGSGTESR-EVTIKKA-------KKD---------ITLLCQQLQLSQHYAD 109
            ..|...:...||   |..|:.| ...:.||       |||         ||:||...:|.:...|
Yeast    87 LDGNNLSTRIGK---GETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKD 148

  Fly   110 TALNFFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICSYELGRT------- 167
            .|...:|:.......:|:....|.||.:.:.||....:....:|..:..:.:.|.|:|       
Yeast   149 CAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNI 213

  Fly   168 --------YLKLSHALCINIPSLDPCLYIMRFANRLQLGAKTHEVSMTALRIVQRMKKDCMHSGR 224
                    :||:.   ..|:.......||.||.:.|.|   ..:|:.:|....::.|:....:|:
Yeast   214 LRGKSEDGFLKID---TDNMSGAQNLTYIPRFCSHLGL---PMQVTTSAEYTAKKCKEIKEIAGK 272

  Fly   225 RPTGLCGAALLIAARMHDFSRTMLDVIGVVKIHESTLR 262
            .|..:...::.:...:.....|...|...:::.|.|::
Yeast   273 SPITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BrfNP_001163636.1 TF_Zn_Ribbon 5..44 CDD:285471 15/40 (38%)
SUA7 6..270 CDD:224323 63/297 (21%)
CYCLIN 108..164 CDD:294043 10/55 (18%)
CYCLIN 183..268 CDD:238003 15/80 (19%)
BRF1 441..531 CDD:285040
SUA7NP_015411.1 SUA7 21..333 CDD:224323 64/298 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.