DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brf and AT3G10330

DIOPT Version :9

Sequence 1:NP_001163636.1 Gene:Brf / 42087 FlyBaseID:FBgn0038499 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_187644.1 Gene:AT3G10330 / 820195 AraportID:AT3G10330 Length:312 Species:Arabidopsis thaliana


Alignment Length:300 Identity:67/300 - (22%)
Similarity:111/300 - (37%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRNCGSN-EIEEDNARGDRVCMNCGSVLEDSLIVSEVQFEEVGHGAA---------------AIG 55
            |.:|..: |:..|::.||.||..||.|||...|....::....:.:.               |.|
plant     6 CSDCKRHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADG 70

  Fly    56 QFVSA-----ESSGGATNYGYGKFQVGSGTESREVTIKKAKKDITLLCQQLQLSQHYADTALNFF 115
            ...:.     .|||...:...|::|.......|.:.:  |.|.|..:..:|.|.....|.|...:
plant    71 GLTTVISKPNGSSGDFLSSSLGRWQNRGSNPDRGLIV--AFKTIATMADRLGLVATIKDRANEIY 133

  Fly   116 KMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICSYELGRTYLKLSHALCINIP 180
            |....:..:|||....:.|||:|:.||.|....      .|::|||...|.|..::..|.     
plant   134 KRVEDQKSSRGRNQDALLAACLYIACRQEDKPR------TVKEICSVANGATKKEIGRAK----- 187

  Fly   181 SLDPCLYIMRFANRLQLGAKTHE-VSMTALRIVQRMKKDCMHSG--------------------- 223
                 .||::     |||.:|.: |.|..:.....|::.|.:.|                     
plant   188 -----EYIVK-----QLGLETGQLVEMGTIHAGDFMRRFCSNLGMTNQTVKAAQESVQKSEEFDI 242

  Fly   224 -RRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIHESTLR 262
             |.|..:..|.:.|..::.|..:.:.|:.....:.|.|:|
plant   243 RRSPISIAAAVIYIITQLSDEKKPLRDISVATGVAEGTIR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BrfNP_001163636.1 TF_Zn_Ribbon 5..44 CDD:285471 14/37 (38%)
SUA7 6..270 CDD:224323 66/299 (22%)
CYCLIN 108..164 CDD:294043 17/55 (31%)
CYCLIN 183..268 CDD:238003 19/102 (19%)
BRF1 441..531 CDD:285040
AT3G10330NP_187644.1 SUA7 6..297 CDD:224323 66/299 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.