DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brf and Brf2

DIOPT Version :9

Sequence 1:NP_001163636.1 Gene:Brf / 42087 FlyBaseID:FBgn0038499 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_079962.1 Gene:Brf2 / 66653 MGIID:1913903 Length:420 Species:Mus musculus


Alignment Length:501 Identity:100/501 - (19%)
Similarity:192/501 - (38%) Gaps:150/501 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTGLKCRNCGSNEIEEDN--ARGDRVCMNCGSVLEDSLIVS----EVQFEEVGHGAAAIGQFVS 59
            |..|.:|.:|||:|:.||:  ::...||.:||.|:.:.::.:    |..|.||.:..:.      
Mouse     1 MPNGSRCPDCGSSELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNFREVTYSRST------ 59

  Fly    60 AESSGGATNYGYGKFQVGSGTESREVTIKKAKKDITLLCQQLQLSQHYADTALNFFKMAL---GR 121
                        |:.:..|..:.|::      :.:..||:.|:|...:.|||:::::.|.   |.
Mouse    60 ------------GENEQVSRCQQRDL------RRVRDLCRILKLPLTFEDTAISYYQKAYQLSGI 106

  Fly   122 HLTRGRKSTHIYAACVYMTCR------TEGTSHLLIDISDVQQICSYELGRTYLKLSHALCINIP 180
            ...|.:|...:...||.:|||      |.||...|: .:|:.....     ||:::...|.:::|
Mouse   107 RAARLQKKEVLVGCCVLITCRQHNWPLTMGTICTLL-YADLDLFSG-----TYMQMVKLLGLDVP 165

  Fly   181 SLDPCL--YIMRFANRLQL-------GAKTHE-----VSMTALRIVQRMKKDCMHSGRRPTGLCG 231
            ||  ||  .:..:.:..:|       .||..|     :|.|.| :|:...:..:.:||.|..:..
Mouse   166 SL--CLADLVKSYCSSFKLFQASPSVPAKYVEDKDKMLSRTLL-LVELADETWLVTGRHPLPIIT 227

  Fly   232 AALLIA---ARMHDFSRTMLDVIGVVKIHESTLRKRLSEFAETPSGGL------TLEEFMTVDLE 287
            ||..:|   .|..|                 .|...|::|.:..:..|      .|:|.:.|.|:
Mouse   228 AATFLAWQSLRPSD-----------------RLTCSLAQFCKLANVDLPYPAASRLQELLAVLLQ 275

  Fly   288 REQDPPSFKAARKKDRERIKDMGEHELTELQKEIDAHLEKDLGKYSNSVYRQLTKGKGLSPLSSP 352
            ........:..:...|..:|.:|                 ||.::.:.:.|              
Mouse   276 MAGQLAWLQVLKLNKRSVVKHIG-----------------DLLQHRHMLVR-------------- 309

  Fly   353 STPNSSSEKDIELEESRQFIEQSNAEVIKELIAKNEDV--------KKSEPGGLVAGIEGLRPDI 409
             |.......::|.::.:| .:|...:      .:.::|        |:..|    |....|.|. 
Mouse   310 -TAFRDGTAEVETQQQQQ-QQQGQGQ------GQQDEVGDGPFDLPKRKRP----ASPTPLLPP- 361

  Fly   410 EAICRVTQSDLEDVEKAKQPQEQELIT--DDLNDDELDQYVLTEEE 453
               |.     |:..::......:..:|  :|::|.|::||:.|.:|
Mouse   362 ---CM-----LKPPKRTHTLPPESAVTGDEDISDSEIEQYLRTPQE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BrfNP_001163636.1 TF_Zn_Ribbon 5..44 CDD:285471 13/44 (30%)
SUA7 6..270 CDD:224323 67/295 (23%)
CYCLIN 108..164 CDD:294043 17/64 (27%)
CYCLIN 183..268 CDD:238003 20/101 (20%)
BRF1 441..531 CDD:285040 6/13 (46%)
Brf2NP_079962.1 SUA7 6..244 CDD:224323 64/287 (22%)
TF_Zn_Ribbon 6..>37 CDD:285471 12/30 (40%)
Repetitive region 72..157 23/96 (24%)
Interaction with target DNA. /evidence=ECO:0000250|UniProtKB:Q9HAW0 108..114 1/5 (20%)
Repetitive region 173..249 18/93 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..387 13/90 (14%)
Required for the formation of a ternary complex with DNA and TBP, not required for interaction with TBP in the absence of DNA. /evidence=ECO:0000250|UniProtKB:Q9HAW0 358..364 3/14 (21%)
Required for interaction with TBP and formation of a ternary complex with DNA and TBP. /evidence=ECO:0000250|UniProtKB:Q9HAW0 366..420 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.