DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brf and AT1G30455

DIOPT Version :9

Sequence 1:NP_001163636.1 Gene:Brf / 42087 FlyBaseID:FBgn0038499 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001117389.1 Gene:AT1G30455 / 6240845 AraportID:AT1G30455 Length:254 Species:Arabidopsis thaliana


Alignment Length:388 Identity:85/388 - (21%)
Similarity:129/388 - (33%) Gaps:161/388 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 LDPCLYIMRFANRLQLGAKTHEVSMTALRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRT 246
            :||..:|.||:|:|..||...:|..||..|:..||.:.|.:||:|:|:|||||..||..|     
plant    14 VDPSTFIPRFSNKLLKGAHNKQVVETATHIIASMKSNWMQTGRKPSGICGAALYTAALSH----- 73

  Fly   247 MLDVIGVVKIHESTLRKRLSEFAETPSGGLTLEEFMTVDLEREQDPPSFKAARKKDRERIKDMGE 311
                                       ||              .|||||:.|.|   ||:::...
plant    74 ---------------------------GG--------------SDPPSFQRAEK---ERMEEKAS 94

  Fly   312 HELTELQKEIDAHLEKDLGKYSNSVYRQLTKGKGLSPLSSPSTPNSSSEKDIELEESRQFIEQSN 376
            .|..:.|:..|                                                  |.| 
plant    95 TEENDKQQNSD--------------------------------------------------ESS- 108

  Fly   377 AEVIKELIAKNEDVKKSEPGGLVAGIEGLRPDIEAICRVTQSDLEDVE---KAKQPQEQELITDD 438
                                                   |.|||:|.|   ..:.|:|..|: :.
plant   109 ---------------------------------------TLSDLDDGELDCYFRNPKEVHLV-EI 133

  Fly   439 LNDDELDQYVLTEEESVAKLEMWKNLNAEYLQEQKERDERLAKEREEGKPERKKRKPRKKVIGPS 503
            :.|.|...|   :|:..|.|....|. :...:..|....:..|::.:.:.|.:|..|      |.
plant   134 IFDHENPGY---DEKEAAALNACNNA-SNLFEASKAAAAKSRKDKRQQRAEEEKNAP------PP 188

  Fly   504 STAGEAIEKMLQEKKISSKINYEILKTLTDGMGGLTDDSPTTSADTKPST-LEELKHQPVIVE 565
            :||.||::.|::.||... .|.:.|:.|.|      ..:...|...|..| :|:.|.:..|||
plant   189 ATAMEAVDSMVKRKKFPD-TNCDYLEELLD------TSAQKASKRLKTETVMEKNKEEHEIVE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BrfNP_001163636.1 TF_Zn_Ribbon 5..44 CDD:285471
SUA7 6..270 CDD:224323 28/87 (32%)
CYCLIN 108..164 CDD:294043
CYCLIN 183..268 CDD:238003 28/84 (33%)
BRF1 441..531 CDD:285040 22/89 (25%)
AT1G30455NP_001117389.1 CYCLIN 12..>82 CDD:238003 34/113 (30%)
BRF1 115..215 CDD:285040 27/111 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3851
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I1367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412601at2759
OrthoFinder 1 1.000 - - FOG0002717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.