DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brf and BRF2

DIOPT Version :9

Sequence 1:NP_001163636.1 Gene:Brf / 42087 FlyBaseID:FBgn0038499 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_060780.2 Gene:BRF2 / 55290 HGNCID:17298 Length:419 Species:Homo sapiens


Alignment Length:496 Identity:104/496 - (20%)
Similarity:184/496 - (37%) Gaps:151/496 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KCRNCGSNEIEEDN--ARGDRVCMNCGSVLEDSLIVSEVQFEEVGHGAAAIGQFVSAESSGGATN 68
            :|.:|||.|:.||:  ::...||.:||.|:.:.::.:  .|.:.|:    :.:...:.|:|    
Human     6 RCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTT--TFSDEGN----LREVTYSRSTG---- 60

  Fly    69 YGYGKFQVGSGTESREVTIKKAK--KDITLLCQQLQLSQHYADTALNFFKMAL---GRHLTRGRK 128
                        |:.:|:..:.:  :.:..||:.|||...:.|||:.:::.|.   |....|.:|
Human    61 ------------ENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQK 113

  Fly   129 STHIYAACVYMTCR------TEGT--SHLLIDIS---------------DVQQICSYELGRTY-- 168
            ...:...||.:|||      |.|.  :.|..|:.               ||..:|..||.:||  
Human   114 KEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCS 178

  Fly   169 -LKLSHALCINIPSLDPCLYIMRFANRLQLGAKTHEVSMTALRIVQRMKKDCMHSGRRPTGLCGA 232
             .||..|    .||: |..|:         ..|...:|.| :::|:...:..:.:||.|..:..|
Human   179 SFKLFQA----SPSV-PAKYV---------EDKEKMLSRT-MQLVELANETWLVTGRHPLPVITA 228

  Fly   233 ALLIA-ARMHDFSRTMLDVIGVVKIHESTLRKRLSEFAETPSGGLTLEEFMTVDLEREQDPPSFK 296
            |..:| ..:....|....:....|:....|....|.         .|:|.:.|.|...:.....:
Human   229 ATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASS---------RLQELLAVLLRMAEQLAWLR 284

  Fly   297 AARKKDRERIKDMGEHELTELQKEIDAHLEKDLGKYSNSVYRQLTKGKGLSPLSSPSTPNSSSEK 361
            ..|...|..:|.:|                 ||.::..|:.|                   |:.:
Human   285 VLRLDKRSVVKHIG-----------------DLLQHRQSLVR-------------------SAFR 313

  Fly   362 DIELE-ESRQFIEQSNAEVIKELIAKNEDVKKSEPGGLVAGI-EGLRPDIEAI----CRVTQSDL 420
            |...| |:|:          ||.....:...:.|.|....|: :|.||...|:    |.:     
Human   314 DGTAEVETRE----------KEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCML----- 363

  Fly   421 EDVEKAKQPQE------QELITDD--LNDDELDQYVLTEEE 453
                  |.|:.      ...:|.|  ::|.|::||:.|.:|
Human   364 ------KSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BrfNP_001163636.1 TF_Zn_Ribbon 5..44 CDD:285471 12/39 (31%)
SUA7 6..270 CDD:224323 67/297 (23%)
CYCLIN 108..164 CDD:294043 19/81 (23%)
CYCLIN 183..268 CDD:238003 16/85 (19%)
BRF1 441..531 CDD:285040 6/13 (46%)
BRF2NP_060780.2 SUA7 5..233 CDD:224323 62/263 (24%)
Repetitive region 72..157 21/84 (25%)
Interaction with target DNA. /evidence=ECO:0000269|PubMed:26638071, ECO:0007744|PDB:4ROC, ECO:0007744|PDB:4ROD, ECO:0007744|PDB:4ROE 108..114 1/5 (20%)
Repetitive region 173..249 20/90 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..351 10/46 (22%)
Required for the formation of a ternary complex with DNA and TBP, not required for interaction with TBP in the absence of DNA. /evidence=ECO:0000269|PubMed:26638071 357..363 1/5 (20%)
Required for interaction with TBP and formation of a ternary complex with DNA and TBP. /evidence=ECO:0000269|PubMed:26638071 365..419 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.