DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brf and TfIIB

DIOPT Version :9

Sequence 1:NP_001163636.1 Gene:Brf / 42087 FlyBaseID:FBgn0038499 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001260349.1 Gene:TfIIB / 34430 FlyBaseID:FBgn0004915 Length:315 Species:Drosophila melanogaster


Alignment Length:267 Identity:64/267 - (23%)
Similarity:120/267 - (44%) Gaps:24/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EDNARGDRVCMNCGSVLEDSLIVSEVQF-----EEVGHGAAAIGQFVSAESSGGATN-------- 68
            ||...||.:|..||.|:.|.:|....::     |:.|...:.:|...:...|||..:        
  Fly    24 EDYRAGDMICSECGLVVGDRVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIGPGTG 88

  Fly    69 ------YGYGKFQVGSGTESREVTIKKAKKDITLLCQQLQLSQHYADTALNFFKMAL-GRHLTRG 126
                  :|..|:|......|.:.::..|.|:|:.:..::.|.:...|.|.|.||... |::| :|
  Fly    89 SASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKNL-KG 152

  Fly   127 RKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICSYELGRTYLKLSHALCINIPSLDPCLYIMRF 191
            |.:....:||:|:.||.||......:|..|.:|...|:||.:.....||..::..:....::.||
  Fly   153 RSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKEIGRCFKLTLKALETSVDLITTADFMCRF 217

  Fly   192 ANRLQLGAKTHEVSMTALRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKI 256
            ...|.|   .:.|...|..|.::..:..:..||.|..:..||:.:|::..:..|:..::..:..:
  Fly   218 CANLDL---PNMVQRAATHIAKKAVEMDIVPGRSPISVAAAAIYMASQASEHKRSQKEIGDIAGV 279

  Fly   257 HESTLRK 263
            .:.|:|:
  Fly   280 ADVTIRQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BrfNP_001163636.1 TF_Zn_Ribbon 5..44 CDD:285471 10/26 (38%)
SUA7 6..270 CDD:224323 64/267 (24%)
CYCLIN 108..164 CDD:294043 19/56 (34%)
CYCLIN 183..268 CDD:238003 16/81 (20%)
BRF1 441..531 CDD:285040
TfIIBNP_001260349.1 SUA7 22..289 CDD:224323 64/267 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438925
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1405
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.