DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Brf and gtf2b

DIOPT Version :9

Sequence 1:NP_001163636.1 Gene:Brf / 42087 FlyBaseID:FBgn0038499 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_955991.1 Gene:gtf2b / 324823 ZFINID:ZDB-GENE-030131-3544 Length:316 Species:Danio rerio


Alignment Length:280 Identity:69/280 - (24%)
Similarity:124/280 - (44%) Gaps:26/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LKCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLIVSEVQFE--------------EVGHGAAAI- 54
            ::|.|.....:.||...||.:|..||.|:.|.:|  :|..|              .||.....: 
Zfish    13 VQCPNHPDALLVEDYRAGDMICPECGLVVRDRVI--DVGSEWRTFSNEKATKDPSRVGDAQNPLL 75

  Fly    55 --GQFVSAESSG-GATN---YGYGKFQVGSGTESREVTIKKAKKDITLLCQQLQLSQHYADTALN 113
              |...:..|.| ||.:   :|..|:|......|.:..:..|.|:||.:..::.|.::..|...|
Zfish    76 NGGDLTTMISKGTGAASFDEFGNSKYQNRRTMSSSDRAMLNAFKEITTMADRINLPRNIIDRTNN 140

  Fly   114 FFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICSYELGRTYLKLSHALCIN 178
            .||....:...:||.:..|.:||:|:.||.||......:|..|.:|...|:||.:..:..||..:
Zfish   141 LFKQVYEQKSLKGRSNDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETS 205

  Fly   179 IPSLDPCLYIMRFANRLQLGAKTHEVSMTALRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDF 243
            :..:....::.||.:.|.|   ..:|.|.|..|.::..:..:..||.|..:..||:.:|::....
Zfish   206 VDLITTGDFMSRFCSNLGL---PKQVQMAATYIARKAVELDLVPGRSPISVAAAAIYMASQASAE 267

  Fly   244 SRTMLDVIGVVKIHESTLRK 263
            .:|..::..:..:.:.|:|:
Zfish   268 KKTQKEIGDIAGVADVTIRQ 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BrfNP_001163636.1 TF_Zn_Ribbon 5..44 CDD:285471 13/38 (34%)
SUA7 6..270 CDD:224323 69/279 (25%)
CYCLIN 108..164 CDD:294043 17/55 (31%)
CYCLIN 183..268 CDD:238003 17/81 (21%)
BRF1 441..531 CDD:285040
gtf2bNP_955991.1 SUA7 14..290 CDD:224323 69/279 (25%)
TF_Zn_Ribbon 14..53 CDD:285471 14/40 (35%)
TFIIB 121..191 CDD:278794 20/69 (29%)
TFIIB 215..285 CDD:278794 15/72 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.