DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIa and beat-VII

DIOPT Version :9

Sequence 1:NP_001287375.1 Gene:beat-IIa / 42086 FlyBaseID:FBgn0038498 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster


Alignment Length:302 Identity:77/302 - (25%)
Similarity:124/302 - (41%) Gaps:71/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VNLIIEPPAVRRGQHVVLRCMYDLDGAPLYSA---KFYRGQLEFYRYTPGEFPNTKVFPFPGIHV 132
            |||:: |..|.||.....:|.:::....|:..   |..:|  :|:.:..|..|..:.....|..:
  Fly    27 VNLVV-PRYVERGSSATFKCTHNVRPEILFKVTWLKVDKG--KFFEFINGRNPPFRNSTIEGAEI 88

  Fly   133 DVSSSNATQVLLRNVGFGLSGNFSCEVTADAPLFSTATAVDTMQVVELPEKRPQV--FTEHTRYE 195
            |..:||..||.|::|.|.|||.|.|||:.|.|:|:.|:| |.:..|.||:..|..  |.:.|.:.
  Fly    89 DWDNSNEQQVTLKDVQFDLSGQFYCEVSTDTPIFTKASA-DELMSVFLPQTGPPTIKFRKRTPFA 152

  Fly   196 PGDVLRANCSTPPSRPRAELTFTINNMVITHVDTEYIRT---------------IDNLIATRISL 245
            .|:.|.|.|:|...||...:|:.||.   ..|:..|:||               ......|::| 
  Fly   153 VGEKLFALCNTTRGRPAPHITWLING---KKVEDRYVRTHHVFSFNGKHQHQRRTQQQQQTQLS- 213

  Fly   246 KMQLQGIHFSSVNPAIYNNVYGL-------------------------------NSVYGHGGPVY 279
            :.|||..:|.......|:..|.:                               :..:||.|.:|
  Fly   214 QQQLQQQYFQQQYFNQYHQQYHIPVGQFMDRYDKSLRWPAGARADEFPHFLSHHHEGHGHHGSLY 278

  Fly   280 APNSNPGGLLLRCSAQIGDLYQEY--------KEIELGTPQK 313
               :||.|.|.... .:|:.::.:        |.:||...|:
  Fly   279 ---NNPFGSLANYH-DVGEFHEVHQRNYDSNKKNMELKKQQQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIaNP_001287375.1 PTZ00491 <209..>261 CDD:240439 15/66 (23%)
beat-VIINP_733162.2 Ig 31..118 CDD:299845 27/89 (30%)
IG_like 34..118 CDD:214653 26/85 (31%)
Ig 141..>183 CDD:299845 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.