DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIa and CG5597

DIOPT Version :9

Sequence 1:NP_001287375.1 Gene:beat-IIa / 42086 FlyBaseID:FBgn0038498 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:286 Identity:55/286 - (19%)
Similarity:94/286 - (32%) Gaps:111/286 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LLLLLGVLLLSMELVEC------------ALRNVNLIIEPPAVRRGQHVVLRCMYDLDGAPLY-S 101
            |:.:|.:.||..:.: |            .|:|..:  ||        .:|.|.|:::.:|.: :
  Fly     5 LIAILAIGLLHRDAL-CYPTRDESEDKIIVLQNEEM--EP--------TILDCDYEVEESPKFIT 58

  Fly   102 AKFYRGQLEFYRYTPG-------EFPNTKVFPFPGIHVDVSSSNATQ-------VLLRNVGFGLS 152
            .|:||.....|::..|       ||.|         .:|.:..::|:       :.|.|.....:
  Fly    59 VKWYRDDKSIYQWIFGTPPYAIPEFRN---------EIDSTYESSTEPSKQYSSLALINPTIATT 114

  Fly   153 GNFSCEVTADAPLFSTATAVDTMQV----VELPEKRPQVFTEHTRYEPGDVLRANCSTPPSRPRA 213
            |::.|.|......||:...|..:.:    :||..|     |.|..      .:.||:.....||.
  Fly   115 GDYKCVVQTSLNTFSSHQRVQVIDLRNYTLELSHK-----TIHNE------TQLNCTVTNVYPRP 168

  Fly   214 ELTFTINNMVITHVDTEYIRTIDNLIATRISLKMQLQGIHFSSVNPAIYNNVYGLNSVYGHGGPV 278
            .:|...|:|.:...:                              |.:|.|..|    |..|..|
  Fly   169 TITIISNDMDVVKRE------------------------------PMVYENEEG----YFDGSAV 199

  Fly   279 ---YAPNSNPGGLLLRCSAQIGDLYQ 301
               |..:.:|            |.||
  Fly   200 VAAYDTDDDP------------DAYQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIaNP_001287375.1 PTZ00491 <209..>261 CDD:240439 6/51 (12%)
CG5597NP_611841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.