DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIa and CG13532

DIOPT Version :9

Sequence 1:NP_001287375.1 Gene:beat-IIa / 42086 FlyBaseID:FBgn0038498 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_611728.1 Gene:CG13532 / 37632 FlyBaseID:FBgn0034788 Length:263 Species:Drosophila melanogaster


Alignment Length:266 Identity:50/266 - (18%)
Similarity:93/266 - (34%) Gaps:98/266 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LLGVL-LLSMELVECALRNVNLII----------EP-PAV--------RRGQHVVLRCMYD---- 93
            ||.|| |||   |..::|..||.:          || |.|        .|.|..||:.:::    
  Fly    13 LLAVLALLS---VTHSVRITNLRVPRTYTLFRDHEPDPLVLDCEVEIGPREQGFVLKWLFNNHSI 74

  Fly    94 ---LDGAPLYSAKFYRGQLEFYRYTPGEFPNTKVFPF---PGIHVDVSSSNATQVLLRNVGFGLS 152
               :.....::..|.:.:::           ||:|..   ||:           :.::|..:.::
  Fly    75 YQWIPSVKGFAMGFMKSKID-----------TKIFTMEGSPGV-----------ISIKNPDWNMT 117

  Fly   153 GNFSCEVTADAPLFSTATAVDTMQVVELPEKRPQVFTEHTRYEPGDVLRAN-----------CST 206
            |.::|             ||.|.:..:....|.|:....:.:    :|.|.           |:.
  Fly   118 GEYTC-------------AVQTFESTDKRSARLQIIVPESDF----MLEARMSGSRMDVDIMCAV 165

  Fly   207 PPSRPRAELTFT----INNMVITHVDTE----YIRTIDNLI-------ATRISLKMQLQGIHFSS 256
            ....|:..|:..    |.:.|:|.:|.:    |..|:...|       .|.|:....|.|.:::.
  Fly   166 QHVFPQPMLSVMFDTHILDSVLTQLDQDPSGLYSMTVRTRIPRDQLESPTPITCAFILVGTNYTK 230

  Fly   257 VNPAIY 262
            ....|:
  Fly   231 RRETIF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIaNP_001287375.1 PTZ00491 <209..>261 CDD:240439 13/66 (20%)
CG13532NP_611728.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.