DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIa and beat-Ib

DIOPT Version :9

Sequence 1:NP_001287375.1 Gene:beat-IIa / 42086 FlyBaseID:FBgn0038498 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster


Alignment Length:275 Identity:101/275 - (36%)
Similarity:146/275 - (53%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RCLLLLLGVLLLSMELVECALRNVNLIIEPPAVRRGQHVVLRCMYDLDGAPLYSAKFYRGQLEFY 112
            |.|.::..:.:.|:..:...|||||:.| |.||:||.:.:|.|.||::...||:.|:|||:.|||
  Fly     9 RRLFIITAIYIASLPGLTVGLRNVNVRI-PSAVKRGDNALLICNYDIENDTLYTVKWYRGRREFY 72

  Fly   113 RYTPGEFPNTKVFPFPG-IHVDVSSSNATQVLLRNVGFGLSGNFSCEVTADAPLFSTATAVDTMQ 176
            ||||.|.|..|:|.... |.|:.:.|||:.||||||...:||.|:|||:||||.|.|:.....|:
  Fly    73 RYTPKENPAWKIFTKTNEIDVETAQSNASHVLLRNVPTSISGKFACEVSADAPTFDTSIVAADME 137

  Fly   177 VVELPEKRPQVFTEHTRYEPGDVLRANCSTPPSRPRAELTFTINNMVITHVDTEYIRTID----- 236
            |||||.:||.:...|:||..|||:..|||:..|:|.|.||:.||::   .|...|:|..|     
  Fly   138 VVELPTQRPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWINDI---QVPPNYLRIYDIQRHV 199

  Fly   237 --NLIATRISLKMQLQGIHFSSVNPAIYNNVYGLNSVYGHGGPVYAPNSNPGGLLLRCSAQIGDL 299
              :|.:..:.:|..:...||..                             ..|.|:|||:|.::
  Fly   200 AEHLESAVLEIKFVVTVHHFIK-----------------------------SRLKLKCSARIHEI 235

  Fly   300 YQEYKE--IELGTPQ 312
            |.:..|  ||...|:
  Fly   236 YAQESEKLIEEDRPR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIaNP_001287375.1 PTZ00491 <209..>261 CDD:240439 15/58 (26%)
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 10/21 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.