DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIb and beat-VI

DIOPT Version :9

Sequence 1:NP_650613.2 Gene:beat-IIb / 42082 FlyBaseID:FBgn0038494 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster


Alignment Length:174 Identity:69/174 - (39%)
Similarity:98/174 - (56%) Gaps:11/174 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IQWL----LLLCLFCDFGQAALRDVNLLVEPPAVRRGQSVALRCDYQLVEAPLYSIKFYRGQMEF 139
            :.|:    |||...|      |:|:.:.| |.||..|.:..|.|.|.|.:|.||::::|.||.||
  Fly    37 LSWIIISELLLSAHC------LKDLKIFV-PEAVLMGNAATLSCQYDLEQAALYAVRWYFGQEEF 94

  Fly   140 YRYTPGEYPPTKVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLYSTATAFAQMQ 204
            |||.|.|..||.||...||.||...|:||:|.::.|:..|||.:.|||:.||||:.|....|.||
  Fly    95 YRYVPREAKPTFVFAVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAHMQ 159

  Fly   205 VVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTIN 248
            |:|.|:..|.:..:.......|..:|.|:..||.|.|::.::||
  Fly   160 VIELPKDDPVMQVDKKVIGVNDNFKAVCTVGPSYPPANITWSIN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIbNP_650613.2 IG_like 108..198 CDD:214653 43/89 (48%)
beat-VINP_001263035.1 Ig 66..142 CDD:416386 35/75 (47%)
Ig strand B 67..76 CDD:409353 2/8 (25%)
CDR1 76..83 CDD:409353 2/6 (33%)
Ig strand C 83..91 CDD:409353 2/7 (29%)
FR2 84..91 CDD:409353 1/6 (17%)
CDR2 94..108 CDD:409353 8/13 (62%)
Ig strand C' 94..99 CDD:409353 4/4 (100%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 14/33 (42%)
Ig strand D 117..121 CDD:409353 0/3 (0%)
Ig strand E 123..127 CDD:409353 2/3 (67%)
Ig strand F 136..144 CDD:409353 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.