DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIb and beat-Vc

DIOPT Version :9

Sequence 1:NP_650613.2 Gene:beat-IIb / 42082 FlyBaseID:FBgn0038494 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001356887.1 Gene:beat-Vc / 41575 FlyBaseID:FBgn0038084 Length:297 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:107/279 - (38%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LLLCLFCDFGQAALRDVNL--LVEPPAVRRGQSVALRCDYQLVEAPLYSIKFYRGQMEFYRYTPG 145
            |||..|..........::|  |..|..:...|...|.|.|.:....|.|:|:|:..:||:||:|.
  Fly    10 LLLATFNGMAPVPAEGLHLSNLSVPRIIDVAQKAKLFCSYAMGNRTLNSVKWYKDGLEFFRYSPL 74

  Fly   146 EYPPTKVFQFPGIRVDENGSNATTVLIRNVSF-----GLSGQFSCEVTADAPLYSTATAFAQMQV 205
            ..|.|..|...|:.: .:||......|.||..     ..|||:.|||:.|||.:......|.|.|
  Fly    75 TPPTTNWFPVKGVTI-ADGSPHCNQFICNVELEKLTAHSSGQYRCEVSGDAPEFKLIDQTANMTV 138

  Fly   206 VEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINN--IPVSIPFTEETQYIRTVDS 268
            ...|:..|.:......|:..|.|.|||||..|.|.|.|.:.|||  .|......:..:..|.||.
  Fly   139 GVLPKFDPFISGVRHAYKYHDYLEANCSTEMSSPMAKLTWYINNKTAPGHSLQPQINEVSRNVDG 203

  Fly   269 --LIASRLSLKLQLQATHFVAGLSAHGNGNGNGNGNGNGNGNGLANALHLGGGGGGAGGGGLILR 331
              |.||.|.|:|.|....|::....                                    |.||
  Fly   204 FHLFASHLHLRLHLDDQRFISKSEM------------------------------------LELR 232

  Fly   332 CTAQIGDLYQEYKEIELGT 350
            |||.|..|....:|..:.|
  Fly   233 CTADIMGLAAVRRESRVRT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIbNP_650613.2 IG_like 108..198 CDD:214653 31/94 (33%)
beat-VcNP_001356887.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.