DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIb and beat-IIIb

DIOPT Version :9

Sequence 1:NP_650613.2 Gene:beat-IIb / 42082 FlyBaseID:FBgn0038494 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster


Alignment Length:310 Identity:87/310 - (28%)
Similarity:139/310 - (44%) Gaps:59/310 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SNSSNYSCNYGSNVIQWLLLLCLFCDFGQAALRDVNLLVEPPAVRRGQSVALRCDYQLVEAPLYS 129
            :.:..||..||:..| .||.||    |.......:..:..|..:.|.:...|.|.:.|....|||
  Fly     4 ATNCRYSLAYGALFI-LLLQLC----FESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYS 63

  Fly   130 IKFYRGQMEFYRYTPGEYPPTKVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLY 194
            :|:|:...|||||.|.:.||.:||..||:.|:...|....|::|:||...:|::.|||:.:||.:
  Fly    64 VKWYKDGFEFYRYVPRDMPPGQVFPLPGVDVELQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSF 128

  Fly   195 STATAFAQMQVVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNIPVSIPFTEE 259
            .|.:....|.||..|:..||:.....||:.||::|.||::..|||...|.:.||.:..:      
  Fly   129 QTVSGHEDMIVVVTPKHGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMHAN------ 187

  Fly   260 TQYIRTVDSLI-------ASRLSLKLQLQATHFVAGLSAHGNGNGNGNGNGNGNGNGLANALHLG 317
            ...:|..:.||       .:||.|:.:::..||     .||:                       
  Fly   188 RSLLRPYEPLIVGREGLEVARLGLEFRVRGXHF-----KHGD----------------------- 224

  Fly   318 GGGGGAGGGGLILRCTAQIGDLYQEYKE--IELGTPQKDPV-PARVTLSS 364
                      :.|:|.|:|..:|.:..|  :|....|:.|| .:|.|:.|
  Fly   225 ----------MKLKCVAKISSVYWQSNEESVESDKHQRIPVLESRETVMS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIbNP_650613.2 IG_like 108..198 CDD:214653 34/89 (38%)
beat-IIIbNP_788071.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.