DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIb and beat-Ic

DIOPT Version :9

Sequence 1:NP_650613.2 Gene:beat-IIb / 42082 FlyBaseID:FBgn0038494 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster


Alignment Length:377 Identity:114/377 - (30%)
Similarity:178/377 - (47%) Gaps:91/377 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TRSNSSNYSCNYGSNVIQWL---LLLCLFCDFGQAALRDVNLLVEPPAVRRGQSVALRCDYQLVE 124
            |..:..::....|.:.|.|:   |||.|..||.: ||:||:::: |.||:||.:....|:|.:..
  Fly    22 TEKDVGSHGSQSGRSCICWISVVLLLILVPDFIE-ALKDVSVMI-PQAVKRGSNALFTCNYDMEN 84

  Fly   125 APLYSIKFYRGQMEFYRYTPGEYPPTKVFQF-PGIRVDENGSNATTVLIRNVSFGLSGQFSCEVT 188
            ..|||:|:|:|:.|||||||.|.|..|||.. .|:.|:.|.||.:.|::::|...:||:|:||::
  Fly    85 DTLYSVKWYKGKREFYRYTPKENPAMKVFAMTSGLNVERNLSNQSHVVLQSVPLNISGKFTCEIS 149

  Fly   189 ADAPLYSTATAFAQMQVVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNIPVS 253
            .:||.:.||....:|:|||.||:...:....:||..||::..|||...|:|.|:|.:|||.|.| 
  Fly   150 VEAPTFQTAMVSGEMEVVELPEEHTVVTGIQARYRIGDLVDGNCSIKYSKPAANLTWTINGIVV- 213

  Fly   254 IPFTEETQYIRTVDSLIASRLSLKLQLQATHFVAGLSAHGNGNGNGNGNGNGNGNGLANALHLGG 318
                 ...:|:|..:......:|:....|.||:                       :.|...|  
  Fly   214 -----PPHHIKTYQTEKRENSTLESVTSAIHFM-----------------------VTNQHFL-- 248

  Fly   319 GGGGAGGGGLILRCTAQIGDLYQEYKE--IELGTPQKDPVPARVTLSSG--------------TG 367
                  .|.:.|:|||.|.|:::|..|  ||...|:        .::||              .|
  Fly   249 ------KGQMRLKCTANIFDIFKEEMESVIEEDRPR--------IMASGRSYDINNYPLEEHTNG 299

  Fly   368 LRGFLE-------TYFA---TSSGPSN------WRGSAGVVAIFLPTALAQL 403
            .||..|       ||::   |:||.|.      |:        |.|:.|.:|
  Fly   300 ERGGFEDHNESYLTYYSADNTASGASTAAHEIFWQ--------FWPSQLTKL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIbNP_650613.2 IG_like 108..198 CDD:214653 38/90 (42%)
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.